SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|22027525|ref|NP_004831.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|22027525|ref|NP_004831.1|
Domain Number 1 Region: 233-431
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.49e-47
Family DBL homology domain (DH-domain) 0.0000000924
Further Details:      
 
Domain Number 2 Region: 424-547
Classification Level Classification E-value
Superfamily PH domain-like 6.56e-36
Family Pleckstrin-homology domain (PH domain) 0.00000126
Further Details:      
 
Domain Number 3 Region: 1-117
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.14e-26
Family Calponin-homology domain, CH-domain 0.00064
Further Details:      
 
Domain Number 4 Region: 162-232
Classification Level Classification E-value
Superfamily SH3-domain 5.12e-24
Family SH3-domain 0.0000196
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|22027525|ref|NP_004831.1|
Sequence length 776
Comment rho guanine nucleotide exchange factor 6 [Homo sapiens]
Sequence
MNPEEQIVTWLISLGVLESPKKTICDPEEFLKSSLKNGVVLCKLINRLMPGSVEKFCLDP
QTEADCINNINDFLKGCATLQVEIFDPDDLYSGVNFSKVLSTLLAVNKATEDQLSERPCG
RSSSLSAANTSQTNPQGAVSSTVSGLQRQSKTVEMTENGSHQLIVKARFNFKQTNEDELS
VCKGDIIYVTRVEEGGWWEGTLNGRTGWFPSNYVREIKSSERPLSPKAVKGFETAPLTKN
YYTVVLQNILDTEKEYAKELQSLLVTYLRPLQSNNNLSTVEVTSLLGNFEEVCTFQQTLC
QALEECSKFPENQHKVGGCLLSLMPHFKSMYLAYCANHPSAVNVLTQHSDELEQFMENQG
ASSPGILILTTNLSKPFMRLEKYVTLLQELERHMEDTHPDHQDILKAIVAFKTLMGQCQD
LRKRKQLELQILSEPIQAWEGEDIKNLGNVIFMSQVMVQYGACEEKEERYLMLFSNVLIM
LSASPRMSGFIYQGKIPIAGTVVTRLDEIEGNDCTFEITGNTVERIVVHCNNNQDFQEWL
EQLNRLIRGPASCSSLSKTSSSSCSAHSSFSSTGQPRGPLEPPQIIKPWSLSCLRPAPPL
RPSAALGYKERMSYILKESSKSPKTMKKFLHKRKTERKPSEEEYVIRKSTAALEEDAQIL
KVIEAYCTSANFQQGHGSSTRKDSIPQVLLPEEEKLIIEETRSNGQTIMEEKSLVDTVYA
LKDEVRELKQENKRMKQCLEEELKSRRDLEKLVRRLLKQTDECIRGESSSKTSILP
Download sequence
Identical sequences Q15052
HR4654 hso003004160.1 hso003004160.2 hso003004160.3 ENSP00000250617 ENSP00000250617 NP_004831.1.87134 NP_004831.1.92137 gi|22027525|ref|NP_004831.1| ENSP00000250617 9606.ENSP00000250617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]