SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|23065529|ref|NP_689423.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|23065529|ref|NP_689423.1|
Domain Number 1 Region: 207-283
Classification Level Classification E-value
Superfamily GAS2 domain-like 9.42e-27
Family GAS2 domain 0.00019
Further Details:      
 
Domain Number 2 Region: 21-170
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.16e-26
Family Calponin-homology domain, CH-domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|23065529|ref|NP_689423.1|
Sequence length 337
Comment GAS2-like protein 1 isoform b [Homo sapiens]
Sequence
MADPVAGIAGSAAKSVRPFRSSEAYVEAMKEDLAEWLNALYGLGLPGGGDGFLTGLATGT
TLCQHANAVTEAARALAAARPARGVAFQAHSVVPGSFMARDNVATFIGWCRVELGVPEVL
MFETEDLVLRKNEKSVVLCLLEVARRGARLGLLAPRLVQFEQEIERELRAAPPAPNAPAA
GEDTTETAPAPGTPARGPRMTPSDLRNLDELVREILGRCTCPDQFPMIKVSEGKYRVGDS
SLLIFVRVLRSHVMVRVGGGWDTLEHYLDKHDPCRCSSTAHRPPQPRVCTFSPQRVSPTT
SPRPASPVPGSERRGSRPEMTPVSLRSTKEGPETPPR
Download sequence
Identical sequences K7ASV1
ENSP00000484130 gi|23065529|ref|NP_689423.1| ENSP00000344012 9606.ENSP00000344012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]