SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|25952152|ref|NP_739577.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|25952152|ref|NP_739577.1|
Domain Number 1 Region: 7-432
Classification Level Classification E-value
Superfamily ALDH-like 6.41e-137
Family ALDH-like 0.000000109
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|25952152|ref|NP_739577.1|
Sequence length 433
Comment aldehyde dehydrogenase family 8 member A1 isoform 2 [Homo sapiens]
Sequence
MAGTNALLMLENFIDGKFLPCSSYIDSYDPSTGEVYCRVPNSGKDEIEAAVKAAREAFPS
WSSRSPQERSRVLNQVADLLEQSLEEFAQAESKDQGKTLALARTMDIPRSVQNFRFFASS
SLHHTSECTQMDHLGCMHYTVRAPVGVAGLISPWNLPLYLLTWKIAPAMAAGNTVIAKPS
ELTSVTAWMLCKLLDKAGVPPGVVNIVFGTGPRVGEALVSHPEVPLISFTGSQPTAERIT
QLSAPHCKKLSLELGGKNPAIIFEDANLDECIPATVRSSFANQVRSYVKRALAEGAQIWC
GEGVDKLSLPARNQAGYFMLPTVITDIKDESCCMTEEIFGPVTCVVPFDSEEEVIERANN
VKYGLAATVWSSNVGRVHRVAKKLQSGLVWTNCWLIRELNLPFGGMKSSGIGREGAKDSY
DFFTEIKTITVKH
Download sequence
Identical sequences ENSP00000356819 NP_739577.1.87134 NP_739577.1.92137 gi|25952152|ref|NP_739577.1| ENSP00000356819

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]