SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|310118380|ref|XP_003119100.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|310118380|ref|XP_003119100.1|
Domain Number 1 Region: 264-608
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.49e-75
Family p120GAP domain-like 0.0000898
Further Details:      
 
Domain Number 2 Region: 112-240
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.44e-32
Family Synaptotagmin-like (S variant) 0.0024
Further Details:      
 
Domain Number 3 Region: 566-708
Classification Level Classification E-value
Superfamily PH domain-like 3.29e-32
Family Pleckstrin-homology domain (PH domain) 0.0049
Further Details:      
 
Domain Number 4 Region: 7-128
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 4.32e-27
Family PLC-like (P variant) 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|310118380|ref|XP_003119100.1|
Sequence length 803
Comment PREDICTED: putative Ras GTPase-activating protein 4B isoform 1 [Homo sapiens]
Sequence
MAKRSSLYIRIVEGKNLPAKDITGSSDPYCIVKVDNEPIIRTATVWKTLCPFWGEEYQVH
LPPTFHAVAFYVMDEDALSRDDVIGKVCLTRDTIASHPKGFSGWAHLTEVDPDEEVQGEI
HLRLEVWPGARACRLRCSVLEARDLAPKDRNGTSDPFVRVRYKGRTRETSIVKKSCYPRW
NETFEFELQEGAMEALCVEAWDWDLVSRNDFLGKVVIDVQRLRVVQQEEGWFRLQPDQSK
SRRHDEGNLGSLQLEVRLRDETVLPSSYYQPLVHLLCHEVKLGMQGPGQLIPLIEETTST
ECRQDVATNLLKLFLGQGLAKDFLDLLFQLELSRTSETNTLFRSNSLASKSVESFLKVAG
MQYLHGVLGPIINKVFEEKKYVELDPSKVEVKDVGCSGLHRPQTEAEVLEQSAQTLRAHL
GALLSALSRSVRACPAVVRATFRQLFRRVRERFPGAQHENVPFIAVTSFLCLRFFSPAIM
SPKLFHLRERHADARTSRTLLLLAKAVQNVGNMDTPASRAKEAWMEPLQPTVHQGVAQLK
DFITKLVDIEEKDELDLQRTLSLQAPPVKEGPLFIHRTKGKGPLMSSSFKKLYFSLTTEA
LSFAKTPSSKKSALIKLANIRAAEKVEEKSFGGSHVMQVIYTDDAGRPQTAYLQCKCVNE
LNQWLSALRKVSINNTGLLGSYHPGVFRGDKWSCCHQKEKTGQGCDKTRSRVTLQEWNDP
LDHDLEAQLIYRHLLGVEAMLWERHRELSGGAEAGTVPTSPGKVPEDSLARLLRVLQDLR
EAHSSSPAGSPPSEPNCLLELQT
Download sequence
Identical sequences C9J798
ENSP00000417895 XP_005250141.1.92137 ENSP00000417895 ENSP00000417373 gi|310118380|ref|XP_003119100.1| 9606.ENSP00000417895

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]