SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|31742516|ref|NP_852090.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|31742516|ref|NP_852090.1|
Domain Number 1 Region: 86-160
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 4.71e-22
Family Frataxin-like 0.0000158
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|31742516|ref|NP_852090.1|
Sequence length 196
Comment frataxin, mitochondrial isoform 2 preproprotein [Homo sapiens]
Sequence
MWTLGRRAVAGLLASPSPAQAQTLTRVPRPAELAPLCGRRGLRTDIDATCTPRRASSNQR
GLNQIWNVKKQSVYLMNLRKSGTLGHPGSLDETTYERLAEETLDSLAEFFEDLADKPYTF
EDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSRYVVDLSVMTGLGKTGCTPT
TACPSMSCWPQSSLKP
Download sequence
Identical sequences ENSP00000379652 NP_852090.1.87134 NP_852090.1.92137 gi|31742516|ref|NP_852090.1| ENSP00000379652

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]