SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|32967262|ref|NP_861967.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|32967262|ref|NP_861967.1|
Domain Number 1 Region: 174-315
Classification Level Classification E-value
Superfamily PH domain-like 1.27e-42
Family Third domain of FERM 0.000000431
Further Details:      
 
Domain Number 2 Region: 68-173
Classification Level Classification E-value
Superfamily Second domain of FERM 3.66e-31
Family Second domain of FERM 0.00000186
Further Details:      
 
Domain Number 3 Region: 19-87
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.72e-20
Family First domain of FERM 0.0000367
Further Details:      
 
Domain Number 4 Region: 462-540
Classification Level Classification E-value
Superfamily Moesin tail domain 4.45e-20
Family Moesin tail domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|32967262|ref|NP_861967.1|
Sequence length 549
Comment merlin isoform 6 [Homo sapiens]
Sequence
MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETW
FFGLQYTIKDTVAWLKMDKKVKKQILDEKIYCPPEASVLLASYAVQAKYGDYDPSVHKRG
FLAQEELLPKRVINLYQMTPEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNY
FAIRNKKGTELLLGVDALGLHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKID
VFKFNSSKLRVNKLILQLCIGNHDLFMRRRKADSLEVQQMKAQAREEKARKQMERQRLAR
EKQMREEAERTRDELERRLLQMKEEATMANEALMRSEETADLLAEKAQITEEEAKLLAQK
AAEAEQEMQRIKATAIRTEEEKRLMEQKVLEAEVLALKMAEESERRAKEADQLKQDLQEA
REAERRAKQKLLEIATKPTYPPMNPIPAPLPPDIPSFNLIGDSLSFDFKDTDMKRLSMEI
EKEKVEYMEKSKHLQEQLNELKTEIEALKLKERETALDILHNENSDRGGSSKHNTIKKPQ
AQGRRPICI
Download sequence
Identical sequences A0A024R1F6 A0A2I2YZG5 A0A2K5P515 A0A2K5WC39 A0A2K5XBN6 A0A2K6D2A3 A0A2K6NI81 F6RI51
ENSP00000354897 gi|32967262|ref|NP_861967.1| NP_861967.1.87134 NP_861967.1.92137 XP_011851097.1.47321 XP_018874190.1.27298 ENSMMUP00000013512 ENSP00000354897

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]