SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|333609267|ref|NP_001194005.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|333609267|ref|NP_001194005.1|
Domain Number 1 Region: 92-219
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.4e-22
Family cAMP-binding domain 0.0039
Further Details:      
 
Domain Number 2 Region: 227-295
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.0000000072
Family cAMP-binding domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|333609267|ref|NP_001194005.1|
Sequence length 423
Comment hypothetical protein LOC140894 isoform 2 [Homo sapiens]
Sequence
MRRHMVTYAWQLLKKELGLYQLAMDIIIMIRVCKMFRQGLRGFREYQIIETAHWKHPIFS
FWDKKMQSRVTFDTMDFIAEEGHFPPKAIQIMQKKPSWRTEDEIQAVCNILQVLDSYRNY
AEPLQLLLAKVMRFERFGRRRVIIKKGQKGNSFYFIYLGTVAITKDEDGSSAFLDPHPKL
LHKGSCFGEMDVLHASVRRSTIVCMEETEFLVVDREDFFANKLDQEVQKDAQYRFEFFRK
MELFASWSDEKLWQLVAMAKIERFSYGQLISKDFGESPFIMFISKGSCEVLRLLDLGASP
SYRRWIWQHLELIDGRPLKTHLSEYSPMERFKEFQIKSYPLQDFSSLKLPHLKKAWGLQG
TSFSRKIRTSGDTLPKMLGPKIQSRPAQSIKCAMINIKPGELPKEAAVGAYVKVHTVEQG
EIL
Download sequence
Identical sequences ENSP00000442729 NP_001194005.1.87134 NP_001194005.1.92137 gi|333609267|ref|NP_001194005.1| ENSP00000442729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]