SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|41281831|ref|NP_775182.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|41281831|ref|NP_775182.1|
Domain Number 1 Region: 319-408
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.08e-19
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.00057
Further Details:      
 
Domain Number 2 Region: 145-197
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000066
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.027
Further Details:      
 
Domain Number 3 Region: 22-82
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000811
Family HLH, helix-loop-helix DNA-binding domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|41281831|ref|NP_775182.1|
Sequence length 920
Comment neuronal PAS domain-containing protein 3 isoform 3 [Homo sapiens]
Sequence
MAPTKPSFQQDPSRRERLQALRKEKSRDAARSRRGKENFEFYELAKLLPLPAAITSQLDK
ASIIRLTISYLKMRDFANQGDPPWNLRMEGPPPNTSVKGIQMWKSELCMRKTPCEVIGAQ
RRRSPSALAIEVFEAHLGSHILQSLDGFVFALNQEGKFLYISETVSIYLGLSQVELTGSS
VFDYVHPGDHVEMAEQLGMKLPPGRGLLSQGTAEDGASSASSSSQSETPEPVESTSPSLL
TTDNTLERSFFIRMKSTLTKRGVHIKSSGYKVIHITGRLRLRVSLSHGRTVPSQIMGLVV
VAHALPPPTINEVRIDCHMFVTRVNMDLNIIYCENRISDYMDLTPVDIVGKRCYHFIHAE
DVEGIRHSHLDLLNKGQCVTKYYRWMQKNGGYIWIQSSATIAINAKNANEKNIIWVNYLL
SNPEYKDTPMDIAQLPHLPEKTSESSETSDSESDSKDTSGITEDNENSKSDEKGNQSENS
EDPEPDRKKSGNACDNDMNCNDDGHSSSNPDSRDSDDSFEHSDFENPKAGEDGFGALGAM
QIKVERYVESESDLRLQNCESLTSDSAKDSDSAGEAGAQASSKHQKRKKRRKRQKGGSAS
RRRLSSASSPGGLDAGLVEPPRLLSSPNSASVLKIKTEISEPINFDNDSSIWNYPPNREI
SRNESPYSMTKPPSSEHFPSPQGGGGGGGGGGGLHVAIPDSVLTPPGADGAAARKTQFGA
SATAALAPVASDPLSPPLSASPRDKHPGNGGGGGGGGGGAGGGGPSASNSLLYTGDLEAL
QRLQAGNVVLPLVHRVTGTLAATSTAAQRVYTTGTIRYAPAEVTLAMQSNLLPNAHAVNF
VDVNSPGFGLDPKTPMEMLYHHVHRLNMSGPFGGAVSAASLTQMPAGNVFTTAEGLFSTL
PFPVYSNGIHAAQTLERKED
Download sequence
Identical sequences NP_775182.1.87134 NP_775182.1.92137 ENSP00000350446 ENSP00000350446 gi|41281831|ref|NP_775182.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]