SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|4758018|ref|NP_004359.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|4758018|ref|NP_004359.1|
Domain Number 1 Region: 5-188
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.96e-50
Family Calponin-homology domain, CH-domain 0.0000329
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|4758018|ref|NP_004359.1|
Sequence length 309
Comment calponin-2 isoform a [Homo sapiens]
Sequence
MSSTQFNKGPSYGLSAEVKNRLLSKYDPQKEAELRTWIEGLTGLSIGPDFQKGLKDGTIL
CTLMNKLQPGSVPKINRSMQNWHQLENLSNFIKAMVSYGMNPVDLFEANDLFESGNMTQV
QVSLLALAGKAKTKGLQSGVDIGVKYSEKQERNFDDATMKAGQCVIGLQMGTNKCASQSG
MTAYGTRRHLYDPKNHILPPMDHSTISLQMGTNKCASQVGMTAPGTRRHIYDTKLGTDKC
DNSSMSLQMGYTQGANQSGQVFGLGRQIYDPKYCPQGTVADGAPSGTGDCPDPGEVPEYP
PYYQEEAGY
Download sequence
Identical sequences A0A2J8R9Y7 K7AZN1 Q5RFN6 Q99439
ENSPPYP00000010439 ENSP00000263097 gi|4758018|ref|NP_004359.1| ENSP00000263097 ENSPPYP00000010439 NP_001124601.1.23681 NP_004359.1.87134 NP_004359.1.92137 9600.ENSPPYP00000010439 9606.ENSP00000263097

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]