SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|48762712|ref|NP_001001713.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|48762712|ref|NP_001001713.1|
Domain Number 1 Region: 12-48
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000727
Family SH3BGR (SH3-binding, glutamic acid-rich protein-like) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|48762712|ref|NP_001001713.1|
Sequence length 128
Comment SH3 domain-binding glutamic acid-rich protein isoform b [Homo sapiens]
Sequence
MRENVPGEKKPQNGIPLPPQIFNEEQYCGDFDSFFSAKEENIIYSFLGLAPPPDSKGSEK
AEEGGETEAQKEGSEDVGNLPEAQEKNEEEGETATEETEEIAMEGAEGEAEEEEETAEGE
EPGEDEDS
Download sequence
Identical sequences ENSP00000370005 ENSP00000370008 ENSP00000370011 gi|48762712|ref|NP_001001713.1| ENSP00000370005 ENSP00000370008 ENSP00000370011 NP_001001713.1.87134 NP_001001713.1.92137 NP_001304671.1.87134 NP_001304671.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]