SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|4885253|ref|NP_005247.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|4885253|ref|NP_005247.1|
Domain Number 1 Region: 27-183
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 8.21e-31
Family Calponin-homology domain, CH-domain 0.0031
Further Details:      
 
Domain Number 2 Region: 201-280
Classification Level Classification E-value
Superfamily GAS2 domain-like 4.84e-30
Family GAS2 domain 0.00000429
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|4885253|ref|NP_005247.1|
Sequence length 313
Comment growth arrest-specific protein 2 [Homo sapiens]
Sequence
MCTALSPKVRSGPGLSDMHQYSQWLASRHEANLLPMKEDLALWLTNLLGKEITAETFMEK
LDNGALLCQLAETMQEKFKESMDANKPTKNLPLKKIPCKTSAPSGSFFARDNTANFLSWC
RDLGVDETCLFESEGLVLHKQPREVCLCLLELGRIAARYGVEPPGLIKLEKEIEQEETLS
APSPSPSPSSKSSGKKSTGNLLDDAVKRISEDPPCKCPNKFCVERLSQGRYRVGEKILFI
RMLHNKHVMVRVGGGWETFAGYLLKHDPCRMLQISRVDGKTSPIQSKSPTLKDMNPDNYL
VVSASYKAKKEIK
Download sequence
Identical sequences A0A2J8P4I5 O43903
NP_001137302.1.87134 NP_001137302.1.92137 NP_005247.1.87134 NP_005247.1.92137 NP_808221.1.87134 NP_808221.1.92137 XP_001173929.1.37143 XP_001173934.1.37143 XP_003830496.1.60992 XP_003830497.1.60992 XP_004050878.1.27298 XP_004050879.1.27298 XP_008954151.1.60992 XP_008954152.1.60992 XP_009458360.1.37143 XP_009458363.1.37143 XP_009458364.1.37143 XP_009458365.1.37143 XP_016873017.1.92137 XP_016873018.1.92137 XP_016873019.1.92137 XP_016873020.1.92137 XP_018892961.1.27298 ENSP00000278187 ENSP00000396708 ENSP00000401145 HR3171 ENSP00000278187 ENSP00000401145 ENSPTRP00000005998 ENSP00000278187 ENSPTRP00000005998 9598.ENSPTRP00000005998 9606.ENSP00000278187 gi|219842340|ref|NP_001137302.1| gi|29540559|ref|NP_808221.1| gi|4885253|ref|NP_005247.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]