SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|5032287|ref|NP_004000.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|5032287|ref|NP_004000.1|
Domain Number 1 Region: 5-232
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.11e-80
Family Calponin-homology domain, CH-domain 0.000000611
Further Details:      
 
Domain Number 2 Region: 3081-3204
Classification Level Classification E-value
Superfamily EF-hand 9.08e-53
Family EF-hand modules in multidomain proteins 0.000000572
Further Details:      
 
Domain Number 3 Region: 3206-3302
Classification Level Classification E-value
Superfamily EF-hand 6.8e-40
Family EF-hand modules in multidomain proteins 0.00000394
Further Details:      
 
Domain Number 4 Region: 2047-2204
Classification Level Classification E-value
Superfamily Spectrin repeat 1.94e-23
Family Spectrin repeat 0.0035
Further Details:      
 
Domain Number 5 Region: 995-1148
Classification Level Classification E-value
Superfamily Spectrin repeat 3.28e-23
Family Spectrin repeat 0.0047
Further Details:      
 
Domain Number 6 Region: 2155-2312
Classification Level Classification E-value
Superfamily Spectrin repeat 1.07e-21
Family Spectrin repeat 0.004
Further Details:      
 
Domain Number 7 Region: 3282-3370
Classification Level Classification E-value
Superfamily RING/U-box 3.06e-21
Family ZZ domain 0.0092
Further Details:      
 
Domain Number 8 Region: 2521-2676
Classification Level Classification E-value
Superfamily Spectrin repeat 8.92e-20
Family Spectrin repeat 0.0088
Further Details:      
 
Domain Number 9 Region: 1099-1259
Classification Level Classification E-value
Superfamily Spectrin repeat 1.38e-19
Family Spectrin repeat 0.0063
Further Details:      
 
Domain Number 10 Region: 332-442
Classification Level Classification E-value
Superfamily Spectrin repeat 6.02e-18
Family Spectrin repeat 0.0033
Further Details:      
 
Domain Number 11 Region: 1209-1363
Classification Level Classification E-value
Superfamily Spectrin repeat 1.7e-17
Family Spectrin repeat 0.0038
Further Details:      
 
Domain Number 12 Region: 2748-2874
Classification Level Classification E-value
Superfamily Spectrin repeat 6.27e-17
Family Spectrin repeat 0.005
Further Details:      
 
Domain Number 13 Region: 2897-3035
Classification Level Classification E-value
Superfamily Spectrin repeat 7.2e-17
Family Spectrin repeat 0.0063
Further Details:      
 
Domain Number 14 Region: 518-656
Classification Level Classification E-value
Superfamily Spectrin repeat 5.76e-16
Family Spectrin repeat 0.0043
Further Details:      
 
Domain Number 15 Region: 1515-1670
Classification Level Classification E-value
Superfamily Spectrin repeat 7.2e-16
Family Spectrin repeat 0.0055
Further Details:      
 
Domain Number 16 Region: 1624-1768
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000095
Family Spectrin repeat 0.0067
Further Details:      
 
Domain Number 17 Region: 1819-1963
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000022
Family Spectrin repeat 0.0051
Further Details:      
 
Domain Number 18 Region: 451-552
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000738
Family Spectrin repeat 0.0044
Further Details:      
 
Domain Number 19 Region: 3043-3080
Classification Level Classification E-value
Superfamily WW domain 0.0000000000341
Family WW domain 0.00012
Further Details:      
 
Domain Number 20 Region: 772-927
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000398
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 21 Region: 2280-2417
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000225
Family Spectrin repeat 0.0072
Further Details:      
 
Domain Number 22 Region: 2467-2535
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000575
Family Spectrin repeat 0.0048
Further Details:      
 
Weak hits

Sequence:  gi|5032287|ref|NP_004000.1|
Domain Number - Region: 912-1004
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000827
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number - Region: 1423-1549
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00216
Family Spectrin repeat 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|5032287|ref|NP_004000.1|
Sequence length 3681
Comment dystrophin Dp427p1 isoform [Homo sapiens]
Sequence
MSEVSSDEREDVQKKTFTKWVNAQFSKFGKQHIENLFSDLQDGRRLLDLLEGLTGQKLPK
EKGSTRVHALNNVNKALRVLQNNNVDLVNIGSTDIVDGNHKLTLGLIWNIILHWQVKNVM
KNIMAGLQQTNSEKILLSWVRQSTRNYPQVNVINFTTSWSDGLALNALIHSHRPDLFDWN
SVVCQQSATQRLEHAFNIARYQLGIEKLLDPEDVDTTYPDKKSILMYITSLFQVLPQQVS
IEAIQEVEMLPRPPKVTKEEHFQLHHQMHYSQQITVSLAQGYERTSSPKPRFKSYAYTQA
AYVTTSDPTRSPFPSQHLEAPEDKSFGSSLMESEVNLDRYQTALEEVLSWLLSAEDTLQA
QGEISNDVEVVKDQFHTHEGYMMDLTAHQGRVGNILQLGSKLIGTGKLSEDEETEVQEQM
NLLNSRWECLRVASMEKQSNLHRVLMDLQNQKLKELNDWLTKTEERTRKMEEEPLGPDLE
DLKRQVQQHKVLQEDLEQEQVRVNSLTHMVVVVDESSGDHATAALEEQLKVLGDRWANIC
RWTEDRWVLLQDILLKWQRLTEEQCLFSAWLSEKEDAVNKIHTTGFKDQNEMLSSLQKLA
VLKADLEKKKQSMGKLYSLKQDLLSTLKNKSVTQKTEAWLDNFARCWDNLVQKLEKSTAQ
ISQAVTTTQPSLTQTTVMETVTTVTTREQILVKHAQEELPPPPPQKKRQITVDSEIRKRL
DVDITELHSWITRSEAVLQSPEFAIFRKEGNFSDLKEKVNAIEREKAEKFRKLQDASRSA
QALVEQMVNEGVNADSIKQASEQLNSRWIEFCQLLSERLNWLEYQNNIIAFYNQLQQLEQ
MTTTAENWLKIQPTTPSEPTAIKSQLKICKDEVNRLSGLQPQIERLKIQSIALKEKGQGP
MFLDADFVAFTNHFKQVFSDVQAREKELQTIFDTLPPMRYQETMSAIRTWVQQSETKLSI
PQLSVTDYEIMEQRLGELQALQSSLQEQQSGLYYLSTTVKEMSKKAPSEISRKYQSEFEE
IEGRWKKLSSQLVEHCQKLEEQMNKLRKIQNHIQTLKKWMAEVDVFLKEEWPALGDSEIL
KKQLKQCRLLVSDIQTIQPSLNSVNEGGQKIKNEAEPEFASRLETELKELNTQWDHMCQQ
VYARKEALKGGLEKTVSLQKDLSEMHEWMTQAEEEYLERDFEYKTPDELQKAVEEMKRAK
EEAQQKEAKVKLLTESVNSVIAQAPPVAQEALKKELETLTTNYQWLCTRLNGKCKTLEEV
WACWHELLSYLEKANKWLNEVEFKLKTTENIPGGAEEISEVLDSLENLMRHSEDNPNQIR
ILAQTLTDGGVMDELINEELETFNSRWRELHEEAVRRQKLLEQSIQSAQETEKSLHLIQE
SLTFIDKQLAAYIADKVDAAQMPQEAQKIQSDLTSHEISLEEMKKHNQGKEAAQRVLSQI
DVAQKKLQDVSMKFRLFQKPANFEQRLQESKMILDEVKMHLPALETKSVEQEVVQSQLNH
CVNLYKSLSEVKSEVEMVIKTGRQIVQKKQTENPKELDERVTALKLHYNELGAKVTERKQ
QLEKCLKLSRKMRKEMNVLTEWLAATDMELTKRSAVEGMPSNLDSEVAWGKATQKEIEKQ
KVHLKSITEVGEALKTVLGKKETLVEDKLSLLNSNWIAVTSRAEEWLNLLLEYQKHMETF
DQNVDHITKWIIQADTLLDESEKKKPQQKEDVLKRLKAELNDIRPKVDSTRDQAANLMAN
RGDHCRKLVEPQISELNHRFAAISHRIKTGKASIPLKELEQFNSDIQKLLEPLEAEIQQG
VNLKEEDFNKDMNEDNEGTVKELLQRGDNLQQRITDERKREEIKIKQQLLQTKHNALKDL
RSQRRKKALEISHQWYQYKRQADDLLKCLDDIEKKLASLPEPRDERKIKEIDRELQKKKE
ELNAVRRQAEGLSEDGAAMAVEPTQIQLSKRWREIESKFAQFRRLNFAQIHTVREETMMV
MTEDMPLEISYVPSTYLTEITHVSQALLEVEQLLNAPDLCAKDFEDLFKQEESLKNIKDS
LQQSSGRIDIIHSKKTAALQSATPVERVKLQEALSQLDFQWEKVNKMYKDRQGRFDRSVE
KWRRFHYDIKIFNQWLTEAEQFLRKTQIPENWEHAKYKWYLKELQDGIGQRQTVVRTLNA
TGEEIIQQSSKTDASILQEKLGSLNLRWQEVCKQLSDRKKRLEEQKNILSEFQRDLNEFV
LWLEEADNIASIPLEPGKEQQLKEKLEQVKLLVEELPLRQGILKQLNETGGPVLVSAPIS
PEEQDKLENKLKQTNLQWIKVSRALPEKQGEIEAQIKDLGQLEKKLEDLEEQLNHLLLWL
SPIRNQLEIYNQPNQEGPFDVQETEIAVQAKQPDVEEILSKGQHLYKEKPATQPVKRKLE
DLSSEWKAVNRLLQELRAKQPDLAPGLTTIGASPTQTVTLVTQPVVTKETAISKLEMPSS
LMLEVPALADFNRAWTELTDWLSLLDQVIKSQRVMVGDLEDINEMIIKQKATMQDLEQRR
PQLEELITAAQNLKNKTSNQEARTIITDRIERIQNQWDEVQEHLQNRRQQLNEMLKDSTQ
WLEAKEEAEQVLGQARAKLESWKEGPYTVDAIQKKITETKQLAKDLRQWQTNVDVANDLA
LKLLRDYSADDTRKVHMITENINASWRSIHKRVSEREAALEETHRLLQQFPLDLEKFLAW
LTEAETTANVLQDATRKERLLEDSKGVKELMKQWQDLQGEIEAHTDVYHNLDENSQKILR
SLEGSDDAVLLQRRLDNMNFKWSELRKKSLNIRSHLEASSDQWKRLHLSLQELLVWLQLK
DDELSRQAPIGGDFPAVQKQNDVHRAFKRELKTKEPVIMSTLETVRIFLTEQPLEGLEKL
YQEPRELPPEERAQNVTRLLRKQAEEVNTEWEKLNLHSADWQRKIDETLERLQELQEATD
ELDLKLRQAEVIKGSWQPVGDLLIDSLQDHLEKVKALRGEIAPLKENVSHVNDLARQLTT
LGIQLSPYNLSTLEDLNTRWKLLQVAVEDRVRQLHEAHRDFGPASQHFLSTSVQGPWERA
ISPNKVPYYINHETQTTCWDHPKMTELYQSLADLNNVRFSAYRTAMKLRRLQKALCLDLL
SLSAACDALDQHNLKQNDQPMDILQIINCLTTIYDRLEQEHNNLVNVPLCVDMCLNWLLN
VYDTGRTGRIRVLSFKTGIISLCKAHLEDKYRYLFKQVASSTGFCDQRRLGLLLHDSIQI
PRQLGEVASFGGSNIEPSVRSCFQFANNKPEIEAALFLDWMRLEPQSMVWLPVLHRVAAA
ETAKHQAKCNICKECPIIGFRYRSLKHFNYDICQSCFFSGRVAKGHKMHYPMVEYCTPTT
SGEDVRDFAKVLKNKFRTKRYFAKHPRMGYLPVQTVLEGDNMETPVTLINFWPVDSAPAS
SPQLSHDDTHSRIEHYASRLAEMENSNGSYLNDSISPNESIDDEHLLIQHYCQSLNQDSP
LSQPRSPAQILISLESEERGELERILADLEEENRNLQAEYDRLKQQHEHKGLSPLPSPPE
MMPTSPQSPRDAELIAEAKLLRQHKGRLEARMQILEDHNKQLESQLHRLRQLLEQPQAEA
KVNGTTVSSPSTSLQRSDSSQPMLLRVVGSQTSDSMGEEDLLSPPQDTSTGLEEVMEQLN
NSFPSSRGRNTPGKPMREDTM
Download sequence
Identical sequences gi|5032287|ref|NP_004000.1| NP_004000.1.87134 NP_004000.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]