SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|5032313|ref|NP_004014.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|5032313|ref|NP_004014.1|
Domain Number 1 Region: 625-748
Classification Level Classification E-value
Superfamily EF-hand 1.4e-53
Family EF-hand modules in multidomain proteins 0.000000572
Further Details:      
 
Domain Number 2 Region: 750-846
Classification Level Classification E-value
Superfamily EF-hand 1.67e-40
Family EF-hand modules in multidomain proteins 0.00000394
Further Details:      
 
Domain Number 3 Region: 826-914
Classification Level Classification E-value
Superfamily RING/U-box 7.65e-22
Family ZZ domain 0.0092
Further Details:      
 
Domain Number 4 Region: 65-226
Classification Level Classification E-value
Superfamily Spectrin repeat 8.23e-22
Family Spectrin repeat 0.007
Further Details:      
 
Domain Number 5 Region: 292-418
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-17
Family Spectrin repeat 0.005
Further Details:      
 
Domain Number 6 Region: 441-579
Classification Level Classification E-value
Superfamily Spectrin repeat 1.7e-17
Family Spectrin repeat 0.0063
Further Details:      
 
Domain Number 7 Region: 587-624
Classification Level Classification E-value
Superfamily WW domain 0.0000000000089
Family WW domain 0.00012
Further Details:      
 
Domain Number 8 Region: 11-82
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000719
Family Spectrin repeat 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|5032313|ref|NP_004014.1|
Sequence length 1133
Comment dystrophin Dp140bc isoform [Homo sapiens]
Sequence
MPSSLMLEVPALADFNRAWTELTDWLSLLDQVIKSQRVMVGDLEDINEMIIKQKATMQDL
EQRRPQLEELITAAQNLKNKTSNQEARTIITDRIERIQNQWDEVQEHLQNRRQQLNEMLK
DSTQWLEAKEEAEQVLGQARAKLESWKEGPYTVDAIQKKITETKQLAKDLRQWQTNVDVA
NDLALKLLRDYSADDTRKVHMITENINASWRSIHKRVSEREAALEETHRLLQQFPLDLEK
FLAWLTEAETTANVLQDATRKERLLEDSKGVKELMKQWQDLQGEIEAHTDVYHNLDENSQ
KILRSLEGSDDAVLLQRRLDNMNFKWSELRKKSLNIRSHLEASSDQWKRLHLSLQELLVW
LQLKDDELSRQAPIGGDFPAVQKQNDVHRAFKRELKTKEPVIMSTLETVRIFLTEQPLEG
LEKLYQEPRELPPEERAQNVTRLLRKQAEEVNTEWEKLNLHSADWQRKIDETLERLQELQ
EATDELDLKLRQAEVIKGSWQPVGDLLIDSLQDHLEKVKALRGEIAPLKENVSHVNDLAR
QLTTLGIQLSPYNLSTLEDLNTRWKLLQVAVEDRVRQLHEAHRDFGPASQHFLSTSVQGP
WERAISPNKVPYYINHETQTTCWDHPKMTELYQSLADLNNVRFSAYRTAMKLRRLQKALC
LDLLSLSAACDALDQHNLKQNDQPMDILQIINCLTTIYDRLEQEHNNLVNVPLCVDMCLN
WLLNVYDTGRTGRIRVLSFKTGIISLCKAHLEDKYRYLFKQVASSTGFCDQRRLGLLLHD
SIQIPRQLGEVASFGGSNIEPSVRSCFQFANNKPEIEAALFLDWMRLEPQSMVWLPVLHR
VAAAETAKHQAKCNICKECPIIGFRYRSLKHFNYDICQSCFFSGRVAKGHKMHYPMVEYC
TPTTSGEDVRDFAKVLKNKFRTKRYFAKHPRMGYLPVQTVLEGDNMETNLQAEYDRLKQQ
HEHKGLSPLPSPPEMMPTSPQSPRDAELIAEAKLLRQHKGRLEARMQILEDHNKQLESQL
HRLRQLLEQPQAEAKVNGTTVSSPSTSLQRSDSSQPMLLRVVGSQTSDSMGEEDLLSPPQ
DTSTGLEEVMEQLNNSFPSSRGHNVGSLFHMADDLGRAMESLVSVMTDEEGAE
Download sequence
Identical sequences gi|5032313|ref|NP_004014.1| NP_004014.1.87134 NP_004014.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]