SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|5032315|ref|NP_004001.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|5032315|ref|NP_004001.1|
Domain Number 1 Region: 2962-3085
Classification Level Classification E-value
Superfamily EF-hand 8.58e-53
Family EF-hand modules in multidomain proteins 0.000000572
Further Details:      
 
Domain Number 2 Region: 3087-3183
Classification Level Classification E-value
Superfamily EF-hand 6.46e-40
Family EF-hand modules in multidomain proteins 0.00000394
Further Details:      
 
Domain Number 3 Region: 9-119
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.32e-32
Family Calponin-homology domain, CH-domain 0.000000619
Further Details:      
 
Domain Number 4 Region: 1928-2085
Classification Level Classification E-value
Superfamily Spectrin repeat 1.87e-23
Family Spectrin repeat 0.0035
Further Details:      
 
Domain Number 5 Region: 876-1029
Classification Level Classification E-value
Superfamily Spectrin repeat 3.12e-23
Family Spectrin repeat 0.0047
Further Details:      
 
Domain Number 6 Region: 2036-2193
Classification Level Classification E-value
Superfamily Spectrin repeat 1.12e-21
Family Spectrin repeat 0.004
Further Details:      
 
Domain Number 7 Region: 3163-3251
Classification Level Classification E-value
Superfamily RING/U-box 2.94e-21
Family ZZ domain 0.0092
Further Details:      
 
Domain Number 8 Region: 2402-2563
Classification Level Classification E-value
Superfamily Spectrin repeat 3.57e-21
Family Spectrin repeat 0.007
Further Details:      
 
Domain Number 9 Region: 980-1140
Classification Level Classification E-value
Superfamily Spectrin repeat 1.31e-19
Family Spectrin repeat 0.0063
Further Details:      
 
Domain Number 10 Region: 213-323
Classification Level Classification E-value
Superfamily Spectrin repeat 5.76e-18
Family Spectrin repeat 0.0033
Further Details:      
 
Domain Number 11 Region: 1090-1244
Classification Level Classification E-value
Superfamily Spectrin repeat 1.31e-17
Family Spectrin repeat 0.0038
Further Details:      
 
Domain Number 12 Region: 2629-2755
Classification Level Classification E-value
Superfamily Spectrin repeat 5.9e-17
Family Spectrin repeat 0.005
Further Details:      
 
Domain Number 13 Region: 2778-2916
Classification Level Classification E-value
Superfamily Spectrin repeat 7.85e-17
Family Spectrin repeat 0.0063
Further Details:      
 
Domain Number 14 Region: 399-537
Classification Level Classification E-value
Superfamily Spectrin repeat 5.96e-16
Family Spectrin repeat 0.0043
Further Details:      
 
Domain Number 15 Region: 1396-1551
Classification Level Classification E-value
Superfamily Spectrin repeat 6.34e-16
Family Spectrin repeat 0.0055
Further Details:      
 
Domain Number 16 Region: 1505-1649
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000907
Family Spectrin repeat 0.0067
Further Details:      
 
Domain Number 17 Region: 1700-1844
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000212
Family Spectrin repeat 0.0051
Further Details:      
 
Domain Number 18 Region: 332-433
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000072
Family Spectrin repeat 0.0044
Further Details:      
 
Domain Number 19 Region: 2924-2961
Classification Level Classification E-value
Superfamily WW domain 0.0000000000341
Family WW domain 0.00012
Further Details:      
 
Domain Number 20 Region: 653-808
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000384
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 21 Region: 2161-2298
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000212
Family Spectrin repeat 0.0072
Further Details:      
 
Domain Number 22 Region: 2348-2419
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000252
Family Spectrin repeat 0.0047
Further Details:      
 
Weak hits

Sequence:  gi|5032315|ref|NP_004001.1|
Domain Number - Region: 793-888
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000683
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number - Region: 1304-1411
Classification Level Classification E-value
Superfamily Spectrin repeat 0.046
Family Spectrin repeat 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|5032315|ref|NP_004001.1|
Sequence length 3562
Comment dystrophin Dp427p2 isoform [Homo sapiens]
Sequence
MKNIMAGLQQTNSEKILLSWVRQSTRNYPQVNVINFTTSWSDGLALNALIHSHRPDLFDW
NSVVCQQSATQRLEHAFNIARYQLGIEKLLDPEDVDTTYPDKKSILMYITSLFQVLPQQV
SIEAIQEVEMLPRPPKVTKEEHFQLHHQMHYSQQITVSLAQGYERTSSPKPRFKSYAYTQ
AAYVTTSDPTRSPFPSQHLEAPEDKSFGSSLMESEVNLDRYQTALEEVLSWLLSAEDTLQ
AQGEISNDVEVVKDQFHTHEGYMMDLTAHQGRVGNILQLGSKLIGTGKLSEDEETEVQEQ
MNLLNSRWECLRVASMEKQSNLHRVLMDLQNQKLKELNDWLTKTEERTRKMEEEPLGPDL
EDLKRQVQQHKVLQEDLEQEQVRVNSLTHMVVVVDESSGDHATAALEEQLKVLGDRWANI
CRWTEDRWVLLQDILLKWQRLTEEQCLFSAWLSEKEDAVNKIHTTGFKDQNEMLSSLQKL
AVLKADLEKKKQSMGKLYSLKQDLLSTLKNKSVTQKTEAWLDNFARCWDNLVQKLEKSTA
QISQAVTTTQPSLTQTTVMETVTTVTTREQILVKHAQEELPPPPPQKKRQITVDSEIRKR
LDVDITELHSWITRSEAVLQSPEFAIFRKEGNFSDLKEKVNAIEREKAEKFRKLQDASRS
AQALVEQMVNEGVNADSIKQASEQLNSRWIEFCQLLSERLNWLEYQNNIIAFYNQLQQLE
QMTTTAENWLKIQPTTPSEPTAIKSQLKICKDEVNRLSGLQPQIERLKIQSIALKEKGQG
PMFLDADFVAFTNHFKQVFSDVQAREKELQTIFDTLPPMRYQETMSAIRTWVQQSETKLS
IPQLSVTDYEIMEQRLGELQALQSSLQEQQSGLYYLSTTVKEMSKKAPSEISRKYQSEFE
EIEGRWKKLSSQLVEHCQKLEEQMNKLRKIQNHIQTLKKWMAEVDVFLKEEWPALGDSEI
LKKQLKQCRLLVSDIQTIQPSLNSVNEGGQKIKNEAEPEFASRLETELKELNTQWDHMCQ
QVYARKEALKGGLEKTVSLQKDLSEMHEWMTQAEEEYLERDFEYKTPDELQKAVEEMKRA
KEEAQQKEAKVKLLTESVNSVIAQAPPVAQEALKKELETLTTNYQWLCTRLNGKCKTLEE
VWACWHELLSYLEKANKWLNEVEFKLKTTENIPGGAEEISEVLDSLENLMRHSEDNPNQI
RILAQTLTDGGVMDELINEELETFNSRWRELHEEAVRRQKLLEQSIQSAQETEKSLHLIQ
ESLTFIDKQLAAYIADKVDAAQMPQEAQKIQSDLTSHEISLEEMKKHNQGKEAAQRVLSQ
IDVAQKKLQDVSMKFRLFQKPANFEQRLQESKMILDEVKMHLPALETKSVEQEVVQSQLN
HCVNLYKSLSEVKSEVEMVIKTGRQIVQKKQTENPKELDERVTALKLHYNELGAKVTERK
QQLEKCLKLSRKMRKEMNVLTEWLAATDMELTKRSAVEGMPSNLDSEVAWGKATQKEIEK
QKVHLKSITEVGEALKTVLGKKETLVEDKLSLLNSNWIAVTSRAEEWLNLLLEYQKHMET
FDQNVDHITKWIIQADTLLDESEKKKPQQKEDVLKRLKAELNDIRPKVDSTRDQAANLMA
NRGDHCRKLVEPQISELNHRFAAISHRIKTGKASIPLKELEQFNSDIQKLLEPLEAEIQQ
GVNLKEEDFNKDMNEDNEGTVKELLQRGDNLQQRITDERKREEIKIKQQLLQTKHNALKD
LRSQRRKKALEISHQWYQYKRQADDLLKCLDDIEKKLASLPEPRDERKIKEIDRELQKKK
EELNAVRRQAEGLSEDGAAMAVEPTQIQLSKRWREIESKFAQFRRLNFAQIHTVREETMM
VMTEDMPLEISYVPSTYLTEITHVSQALLEVEQLLNAPDLCAKDFEDLFKQEESLKNIKD
SLQQSSGRIDIIHSKKTAALQSATPVERVKLQEALSQLDFQWEKVNKMYKDRQGRFDRSV
EKWRRFHYDIKIFNQWLTEAEQFLRKTQIPENWEHAKYKWYLKELQDGIGQRQTVVRTLN
ATGEEIIQQSSKTDASILQEKLGSLNLRWQEVCKQLSDRKKRLEEQKNILSEFQRDLNEF
VLWLEEADNIASIPLEPGKEQQLKEKLEQVKLLVEELPLRQGILKQLNETGGPVLVSAPI
SPEEQDKLENKLKQTNLQWIKVSRALPEKQGEIEAQIKDLGQLEKKLEDLEEQLNHLLLW
LSPIRNQLEIYNQPNQEGPFDVQETEIAVQAKQPDVEEILSKGQHLYKEKPATQPVKRKL
EDLSSEWKAVNRLLQELRAKQPDLAPGLTTIGASPTQTVTLVTQPVVTKETAISKLEMPS
SLMLEVPALADFNRAWTELTDWLSLLDQVIKSQRVMVGDLEDINEMIIKQKATMQDLEQR
RPQLEELITAAQNLKNKTSNQEARTIITDRIERIQNQWDEVQEHLQNRRQQLNEMLKDST
QWLEAKEEAEQVLGQARAKLESWKEGPYTVDAIQKKITETKQLAKDLRQWQTNVDVANDL
ALKLLRDYSADDTRKVHMITENINASWRSIHKRVSEREAALEETHRLLQQFPLDLEKFLA
WLTEAETTANVLQDATRKERLLEDSKGVKELMKQWQDLQGEIEAHTDVYHNLDENSQKIL
RSLEGSDDAVLLQRRLDNMNFKWSELRKKSLNIRSHLEASSDQWKRLHLSLQELLVWLQL
KDDELSRQAPIGGDFPAVQKQNDVHRAFKRELKTKEPVIMSTLETVRIFLTEQPLEGLEK
LYQEPRELPPEERAQNVTRLLRKQAEEVNTEWEKLNLHSADWQRKIDETLERLQELQEAT
DELDLKLRQAEVIKGSWQPVGDLLIDSLQDHLEKVKALRGEIAPLKENVSHVNDLARQLT
TLGIQLSPYNLSTLEDLNTRWKLLQVAVEDRVRQLHEAHRDFGPASQHFLSTSVQGPWER
AISPNKVPYYINHETQTTCWDHPKMTELYQSLADLNNVRFSAYRTAMKLRRLQKALCLDL
LSLSAACDALDQHNLKQNDQPMDILQIINCLTTIYDRLEQEHNNLVNVPLCVDMCLNWLL
NVYDTGRTGRIRVLSFKTGIISLCKAHLEDKYRYLFKQVASSTGFCDQRRLGLLLHDSIQ
IPRQLGEVASFGGSNIEPSVRSCFQFANNKPEIEAALFLDWMRLEPQSMVWLPVLHRVAA
AETAKHQAKCNICKECPIIGFRYRSLKHFNYDICQSCFFSGRVAKGHKMHYPMVEYCTPT
TSGEDVRDFAKVLKNKFRTKRYFAKHPRMGYLPVQTVLEGDNMETPVTLINFWPVDSAPA
SSPQLSHDDTHSRIEHYASRLAEMENSNGSYLNDSISPNESIDDEHLLIQHYCQSLNQDS
PLSQPRSPAQILISLESEERGELERILADLEEENRNLQAEYDRLKQQHEHKGLSPLPSPP
EMMPTSPQSPRDAELIAEAKLLRQHKGRLEARMQILEDHNKQLESQLHRLRQLLEQPQAE
AKVNGTTVSSPSTSLQRSDSSQPMLLRVVGSQTSDSMGEEDLLSPPQDTSTGLEEVMEQL
NNSFPSSRGRNTPGKPMREDTM
Download sequence
Identical sequences gi|5032285|ref|NP_003998.1| gi|5032315|ref|NP_004001.1| NP_004001.1.87134 NP_004001.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]