SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|50897284|ref|NP_001002913.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|50897284|ref|NP_001002913.1|
Domain Number 1 Region: 30-205
Classification Level Classification E-value
Superfamily Peptidyl-tRNA hydrolase-like 1.24e-46
Family Peptidyl-tRNA hydrolase-like 0.0000911
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|50897284|ref|NP_001002913.1|
Sequence length 214
Comment probable peptidyl-tRNA hydrolase [Homo sapiens]
Sequence
MRPGGFLGAGQRLSRAMSRCVLEPRPPGKRWMVAGLGNPGLPGTRHSVGMAVLGQLARRL
GVAESWTRDRHCAADLALAPLGDAQLVLLRPRRLMNANGRSVARAAELFGLTAEEVYLVH
DELDKPLGRLALKLGGSARGHNGVRSCISCLNSNAMPRLRVGIGRPAHPEAVQAHVLGCF
SPAEQELLPLLLDRATDLILDHIRERSQGPSLGP
Download sequence
Identical sequences A0A2I3RMH2 Q86Y79
ENSP00000418661 ENSP00000439469 ENSPTRP00000048917 ENSP00000418661 ENSP00000439469 ENSPTRP00000048917 9598.ENSPTRP00000048917 9606.ENSP00000418661 ENSP00000418661 NP_001002913.1.87134 NP_001002913.1.92137 gi|50897284|ref|NP_001002913.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]