SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|51477696|ref|NP_001003828.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|51477696|ref|NP_001003828.1|
Domain Number 1 Region: 70-239,285-395
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.96e-52
Family Calponin-homology domain, CH-domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|51477696|ref|NP_001003828.1|
Sequence length 397
Comment beta-parvin isoform a [Homo sapiens]
Sequence
MHHVFKDHQRGEKRGFLSPENKNCRRLELRRGCSCSWGLCSQALMASLAGSLLPGSDRSG
VETSEYAQGGVSDLQEEGKNAINSPMSPALVDVHPEDTQLEENEERTMIDPTSKEDPKFK
ELVKVLLDWINDVLVEERIIVKQLEEDLYDGQVLQKLLEKLAGCKLNVAEVTQSEIGQKQ
KLQTVLEAVHDLLRPRGWALRWSVDSIHGKNLVAILHLLVSLAMHFRAPIRLPEHVTVQV
VVVRKREGLLHSSHISEELTTTTEMMMGRFERDAFDTLFDHAPDKLSVVKKSLITFVNKH
LNKLNLEVTELETQFADGVYLVLLMGLLEDYFVPLHHFYLTPESFDQKVHNVSFAFELML
DGGLKKPKARPEDVVNLDLKSTLRVLYNLFTKYKNVE
Download sequence
Identical sequences 9606.ENSP00000384515 NP_001003828.1.87134 NP_001003828.1.92137 gi|51477696|ref|NP_001003828.1| ENSP00000384515 ENSP00000342492 ENSP00000384515

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]