SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|7706507|ref|NP_057409.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|7706507|ref|NP_057409.1|
Domain Number 1 Region: 122-211
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.37e-35
Family SCAN domain 0.0000532
Further Details:      
 
Domain Number 2 Region: 539-596
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.24e-24
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 3 Region: 484-540
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.65e-22
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 4 Region: 249-304
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.83e-20
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 
Domain Number 5 Region: 8-56
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.31e-19
Family KRAB domain (Kruppel-associated box) 0.00079
Further Details:      
 
Domain Number 6 Region: 430-484
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000313
Family Classic zinc finger, C2H2 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|7706507|ref|NP_057409.1|
Sequence length 621
Comment neurotrophin receptor-interacting factor homolog isoform a [Homo sapiens]
Sequence
MASRLPTAWSCEPVTFEDVTLGFTPEEWGLLDLKQKSLYREVMLENYRNLVSVEYPELQL
DPKLDPLPAESPLMNIEVVEVLTLNQEVAGPRNAQIQALYAEDGSLSADAPSEQVQQQGK
HPGDPEAARQRFRQFRYKDMTGPREALDQLRELCHQWLQPKARSKEQILELLVLEQFLGA
LPVKLRTWVESQHPENCQEVVALVEGVTWMSEEEVLPAGQPAEGTTCCLEVTAQQEEKQE
DAAICPVTVLPEEPVTFQDVAVDFSREEWGLLGPTQRTEYRDVMLETFGHLVSVGWETTL
ENKELAPNSDIPEEEPAPSLKVQESSRDCALSSTLEDTLQGGVQEVQDTVLKQMESAQEK
DLPQKKHFDNRESQANSGALDTNQVSLQKIDNPESQANSGALDTNQVLLHKIPPRKRLRK
RDSQVKSMKHNSRVKIHQKSCERQKAKEGNGCRKTFSRSTKQITFIRIHKGSQVCRCSEC
GKIFRNPRYFSVHKKIHTGERPYVCQDCGKGFVQSSSLTQHQRVHSGERPFECQECGRTF
NDRSAISQHLRTHTGAKPYKCQDCGKAFRQSSHLIRHQRTHTGERPYACNKCGKAFTQSS
HLIGHQRTHNRTKRKKKQPTS
Download sequence
Identical sequences gi|7706507|ref|NP_057409.1| NP_057409.1.87134 NP_057409.1.92137 ENSP00000321187

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]