SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|374299234|ref|YP_005050873.1| from Desulfovibrio africanus str. Walvis Bay

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374299234|ref|YP_005050873.1|
Domain Number 1 Region: 25-117
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.36e-27
Family ArsR-like transcriptional regulators 0.00077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|374299234|ref|YP_005050873.1|
Sequence length 121
Comment regulatory protein ArsR [Desulfovibrio africanus str. Walvis Bay]
Sequence
MNSTESDVCQVTCVHAERINEVRRDMAAEADLQALSELFKILGDMTRVRILEALSLAELC
VCDLAEILALSQSAVSHQLRLLRAAKLVKYRREGKNAYYSLDDEHVAHLFAEALDHIKED
R
Download sequence
Identical sequences F3YWB1
gi|374299234|ref|YP_005050873.1| WP_014259035.1.78858

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]