SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|374299731|ref|YP_005051370.1| from Desulfovibrio africanus str. Walvis Bay

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374299731|ref|YP_005051370.1|
Domain Number 1 Region: 7-76
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.03e-25
Family Dissimilatory sulfite reductase DsvD 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|374299731|ref|YP_005051370.1|
Sequence length 80
Comment dissimilatory sulfite reductase D [Desulfovibrio africanus str. Walvis Bay]
Sequence
MPFDPATAKDEVLKFLEEKREKKTKFYFNDFTALFPDGKPREVKKILSDLVKEEKLEYWS
SGSTTMYGLKGAGKHASGED
Download sequence
Identical sequences F3YZL2
WP_014259501.1.46467 WP_014259501.1.78858 gi|374299731|ref|YP_005051370.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]