SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|374300514|ref|YP_005052153.1| from Desulfovibrio africanus str. Walvis Bay

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374300514|ref|YP_005052153.1|
Domain Number 1 Region: 4-102
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.66e-24
Family ArsR-like transcriptional regulators 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|374300514|ref|YP_005052153.1|
Sequence length 123
Comment ArsR family transcriptional regulator [Desulfovibrio africanus str. Walvis Bay]
Sequence
MKINCEIFSSLFKALSEEIRLRILALLASSTTSAKGELCVCDIMSALDIPQSTASRHLAH
LRGAGLVKGRRKGAWTYYRLVQDGEGPWKWLEQALNDLRRECPQIRQDLEALKRYLLTKQ
DAC
Download sequence
Identical sequences F3YWK1
WP_014260235.1.78858 gi|374300514|ref|YP_005052153.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]