SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|374301198|ref|YP_005052837.1| from Desulfovibrio africanus str. Walvis Bay

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374301198|ref|YP_005052837.1|
Domain Number 1 Region: 4-135
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000000261
Family MarR-like transcriptional regulators 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|374301198|ref|YP_005052837.1|
Sequence length 147
Comment regulatory protein MarR [Desulfovibrio africanus str. Walvis Bay]
Sequence
MTTDLISKLFLVHSVIRRAINTAFKQAGLVWNFEHFIFLAAIPAGKGIPLKYIATTVFGR
DQSAMRRALSALEKAKLIKLKREIEDRRHLRVHITSEGIEVLASLNRLALDSMDTALFSD
EQETLVKLSGMLDQLQPPMDFESSQVA
Download sequence
Identical sequences F3Z1P3
WP_014260844.1.78858 gi|374301198|ref|YP_005052837.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]