SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|374301942|ref|YP_005053581.1| from Desulfovibrio africanus str. Walvis Bay

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374301942|ref|YP_005053581.1|
Domain Number 1 Region: 11-113
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 8.33e-37
Family HxlR-like 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|374301942|ref|YP_005053581.1|
Sequence length 133
Comment HxlR family transcriptional regulator [Desulfovibrio africanus str. Walvis Bay]
Sequence
MACELKTCGDKNYYCSIELSLLVIGGKWKPIILWRLGQDGTLRFGELKRIMPNITQKMLT
QQLRELEADGLVRRQVYPEVPPRVEYSLTDFGRSVTPVLEQLCKWGHRFEEEHRRREDEK
AEAGLPAMEAMAE
Download sequence
Identical sequences F3YYU6
WP_014261533.1.78858 gi|374301942|ref|YP_005053581.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]