SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|429506835|ref|YP_007188019.1| from Bacillus amyloliquefaciens subsp. plantarum AS43.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|429506835|ref|YP_007188019.1|
Domain Number 1 Region: 2-129
Classification Level Classification E-value
Superfamily FlgN-like 5.1e-19
Family FlgN-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|429506835|ref|YP_007188019.1|
Sequence length 160
Comment hypothetical protein B938_16725 [Bacillus amyloliquefaciens subsp. plantarum AS43.3]
Sequence
MSAKPIIDQLKRLCALHEHLLTLSEEKTEALKAGKTKELSNILTKEQKYIQAIGQTEEER
IRLTSQFLSRGEDNTIAACISRTSGSEKQELEGLFHSLSALLDRLKEVNEMNKQLTIQAL
QFISGAFDMIMPGEKENMNYKEPQAARKPVSRLTLFDSKA
Download sequence
Identical sequences A0A0D7XUB7 A0A142F8Y4 A0A1D9PQC2 A0A1N7FIA4 A0A2D3DT38 A7Z9B1 I2CAR7 S6FZL3
gi|375363977|ref|YP_005132016.1| gi|387900170|ref|YP_006330466.1| gi|384267076|ref|YP_005422783.1| gi|429506835|ref|YP_007188019.1| WP_003151394.1.10011 WP_003151394.1.100906 WP_003151394.1.101182 WP_003151394.1.10180 WP_003151394.1.10479 WP_003151394.1.10853 WP_003151394.1.11256 WP_003151394.1.13676 WP_003151394.1.14108 WP_003151394.1.17514 WP_003151394.1.17976 WP_003151394.1.18446 WP_003151394.1.211 WP_003151394.1.21189 WP_003151394.1.21864 WP_003151394.1.23363 WP_003151394.1.23850 WP_003151394.1.24336 WP_003151394.1.26408 WP_003151394.1.27978 WP_003151394.1.3071 WP_003151394.1.3136 WP_003151394.1.34580 WP_003151394.1.34883 WP_003151394.1.35373 WP_003151394.1.35817 WP_003151394.1.36989 WP_003151394.1.37381 WP_003151394.1.37657 WP_003151394.1.39952 WP_003151394.1.4124 WP_003151394.1.44318 WP_003151394.1.44634 WP_003151394.1.45361 WP_003151394.1.46424 WP_003151394.1.48095 WP_003151394.1.4883 WP_003151394.1.48909 WP_003151394.1.52667 WP_003151394.1.52720 WP_003151394.1.52960 WP_003151394.1.53492 WP_003151394.1.53942 WP_003151394.1.54902 WP_003151394.1.55276 WP_003151394.1.55373 WP_003151394.1.55877 WP_003151394.1.55959 WP_003151394.1.57138 WP_003151394.1.5788 WP_003151394.1.58329 WP_003151394.1.61124 WP_003151394.1.62170 WP_003151394.1.62871 WP_003151394.1.66543 WP_003151394.1.66574 WP_003151394.1.67719 WP_003151394.1.68714 WP_003151394.1.6973 WP_003151394.1.72983 WP_003151394.1.72986 WP_003151394.1.73139 WP_003151394.1.74118 WP_003151394.1.75310 WP_003151394.1.77593 WP_003151394.1.78242 WP_003151394.1.78914 WP_003151394.1.79354 WP_003151394.1.80280 WP_003151394.1.80415 WP_003151394.1.8147 WP_003151394.1.85402 WP_003151394.1.85444 WP_003151394.1.86493 WP_003151394.1.87529 WP_003151394.1.89039 WP_003151394.1.89464 WP_003151394.1.90093 WP_003151394.1.92694 WP_003151394.1.93013 WP_003151394.1.93153 WP_003151394.1.95227 WP_003151394.1.96909 WP_003151394.1.97374 WP_003151394.1.97917 WP_003151394.1.97992 gi|556559125|ref|YP_008728660.1| gi|154687657|ref|YP_001422818.1| gi|530615920|ref|YP_008422581.1| gi|530571155|ref|YP_008414370.1| 326423.RBAM_032570 gi|451345306|ref|YP_007443937.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]