SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HmN_000175600.1 from Hymenolepis microstoma

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HmN_000175600.1
Domain Number 1 Region: 278-452
Classification Level Classification E-value
Superfamily Tropomyosin 0.000000144
Family Tropomyosin 0.0033
Further Details:      
 
Domain Number 2 Region: 172-247
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000301
Family Tropomyosin 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HmN_000175600.1
Sequence length 1866
Sequence
MFPRRSSLPSNPSNENTAVRRECRTFEPQQWRRSVCKNCFRTEPEHNMPNTTTPIATNTV
QNQNPITSTAVSTIEGVPGTINAWPATPAVSRKSGPMDSGQSRAPGQTPAPTRRSGQNTQ
RSADEIQRGIPQRGTPAPSQILLPQSLGPDRAAQVGASGVFSSASSIDARYVEELENDFF
DLEDKYDALARERNDLSMELEAKVRSIEELQVSLEQYKEKAATLERRCTHLEEEIKTYRE
RLRLPESDQGGVAGGTGVDLKASALVAALEGGEGSDDLKIRLNQVEQLCQDVMEENEALK
EEIEEMQREIEEMHDHFQEEDRDSLREMQRDLEAANKTCRILQFKLRKAERRFEQVEAER
ASLEERLSRLESQLYSETDIGHIRTLEDELRIAKEVTTRLNNELDILEEKRQFYEDENHQ
LKDELQLCQNRRITSENEVDRLRLELDKLKCESRFAERGPLQVTDKKAGRQSTALSTTPP
ALSTEQNELIRALQTTKEREADLSEQLRFAEEELRKMNRRMAEAQADNNALSRQLERLSM
QQARGESPRATASQVKKEFAATQQEAKRAEVDETAEKLKAAQEELENRKETDALITKRMR
QLANELLTLKATYKEIDWLEKCNEAIEAQRDAENQVTSLKRRLLESSTDLPSSVVARIES
RRPSLKSSESRAAMSKDWLLQKLDIYDKEMSDLETEISALRNLTDNLKMQSQKLGEEHAE
FKNEADQREKDLRIHIENLEKKDFIVSNLLELMVQRTNFLQEQLEKSNPKDVDKESTTEL
KNLQEILHKEREKARILEEQLKSGALVIPRPMLSENERSRLKEIDVLKSQLEEKEEIIED
HESQIRDLRNRLERAKKMNDAMKILIDKDAVDSCRISASTSSPASAVASLENKQNALEIS
GYRKEIDSMRKEIAILQQKVLQIEKVREKLILENKDLQEELKLREDSLFDQDDELEKRNA
DLAKAKRALELMHVELNEARKGLAAARAQEGMSTKISTTLAENERLKSELRRLEEELSVT
MTNLEKARTMEADILEKNKQLALELKNKENHVQEKEDLLNEVKKDSQRLDEELNSTRQAA
TEAQNKIKKLEATIVEQQKKIKQNENGNLGTDSASDSAVGRDSNRDSRRTEMDRLRRECT
ALRQERDEIAKEARRDRQLFEKRLQEACNKLNSLSETSPSSAPRSAVVGDLFTRATAEKQ
ISKKLNLFNEHIAKQNSIISQLKIKNEIIQNKVLEYQRRYVNLKEQYEAEQEAWLSERVV
LESKAKEQEERKNTIASTRKSLQEASIRLAEVELNFEKERQKFESELARLETEKSELKVQ
LAQLKEQQKLPKVLQRFSASPARSGHISMVNAAASGNVANTETARRLDSAERTIARLKTE
IQNRIEAQSQITIDAIKEAEAARGAAECQMECLNEQLLQLNLYREQAELFRERLIESEQG
ADREYKIWTEEREDLLCRIEDSRISVEQWCIRLANREGIEGLKSEEIINDIVAEMERWRN
CRQHMPTFQRRSHTSDTQSMMGESMLGTPASQPKTPLSASHRSTSVEWFNRSGNGGFRGS
TVSLAGGISSSLARSVTPSLSRCGRSVSPDVSVRKITNYPDPTPGFLIRSRQPSVDSLGS
VSDLSTRPFNSPGKPPLRQPISPARRKFFEESSAAIPSEPGSLKAESFTFPLSSSNIIIK
HPAELRHATTFVPASSSNTESLEGNSSLAASVPPKKDPSPSVLSRISSKLTGSKTDLSRH
KTPPKEKRQSPPKVASSSSPSKSPKQKKKSPPRTSPPKTTSMPSQKSASDSVKTSTTTPT
VKVQPLSTKRRESEMIQSIASKLHSTAEASTKTPVSFPLKTSRSVSLTTPSISPSIMALR
QKFGGK
Download sequence
Identical sequences HmN_000175600.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]