SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HmN_000348100.1 from Hymenolepis microstoma

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HmN_000348100.1
Domain Number 1 Region: 414-813
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.44e-110
Family Ankyrin repeat 0.0000000102
Further Details:      
 
Domain Number 2 Region: 175-432
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.66e-74
Family Ankyrin repeat 0.00000411
Further Details:      
 
Domain Number 3 Region: 24-257
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.67e-64
Family Ankyrin repeat 0.000027
Further Details:      
 
Domain Number 4 Region: 1504-1585
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000000706
Family DEATH domain, DD 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HmN_000348100.1
Sequence length 2024
Sequence
MTKGTDLHHGSNKRGAAGDTGESFLRAARAGDLKKVLDLINSGVFINSTNPTGLTALHLA
AKEGHIEVVNELIRNGADVNAVSKKGNTSLHIASLAGHLDVVKALLDANANPNCQSVVGF
TPLYMAAQENHLDVVILLLNRGANQSLTTEDGFTPLAVALQQGHDRVVATLLERDTRSRG
GLPALHVAARKDDLNSANLLLMSPDANVNHQSQPGFTALHIAAHYGSSNVGGLLIQRGAD
VNFQAKNNITPLHVAAKWGRISMVKLLLDNGALVDSRTRDGLTPLHCAARSGHNTVCTML
IDAGCNPSAKTRNGLTPLHMAAQGNHEEVARNLIAQGASLQAATGDFLNPLHVAAHCGNV
KVAKVLIDKGCDMNARALNGFTPLHIACKKNKIPVVELLLSRGAQISSTTEAGLTPLHVA
AFIGSAELVRVLLERGASVEQTTMRGETPLHLGARSCRPEVAELLLTHGAAVDAKAKDEQ
TPLHIATLCGCAEMVYLLLKFGADPNTATRDAYTSLHIAAKDGRADIVQCLLANGADSDA
RTRRGFTPLHLAAKRGRAEAGRTLLQVMRAEAVNAVGRNGLTPLHMAAHYNHVQIVQLLL
EFGADPDLTATNGYTALHIAAKRNHLDMASLLLANDRDPKRSTNRESRCGFTPLHLAAQE
GNTDMVGLLLLNGADAEHKAKNGLTPMHLAALEDHVTVAQQLVQEGAKATDVTQAGYTPL
HTACYAGRLNMARFFISLSSSDVNAKTCAGFTPLHLAAQQGHSEIVYLLLEHGTDPNAKN
NQGLTPAEIARHQHYFAIFDTLKTITTVVDDWEENRTPGNEEVFLDLPEITATISEAAEA
EESDDEGMMLPHQADYTSSYPSQYQKEYVRASIQHPNSLHPRESSYENDLIWGEMEYLSH
PMHEQLLHETSAVSDHTENLSATLISDLQMGETSKVLAGPGDHLDAEWEMETEPTLSATK
KPHSGGFLVSFLVDARGGLLESKRYPGLRFIIPPNASIGPLRIICRLLRYPSYSVQPPFN
DGEGLACRLIEVGPVGVHFNSPILIEVPYCASIRNNQREIIVLRSESGEIWKEHPVDPTD
QAVQDSLGAYFSDAIPATELKKRRVHRILTNSIPQYFALVTRNRQDLILVGPEGCTLTSS
VDPQVKVSFPRGALQKKIRVGLQVQTVDPRLVEECLGSPRIAVSPIVTIEPRRRKFHRPI
MVFIPLPKVGGKGENQGGGKNQTSDLSTVRLLCSITGGTAQAIWEDITGSSPFSLQKDCV
SFTTTVSARLWLIDCPNLSEVSEMATRVYREAVAVPYLGRFVVYGRRHHPEESHVRCVCL
TDDTEQKTLECQEGFEVIARSGGGGSGDVADDSGLVEFLHNRSIWVETAGNLVPVAGIAS
PTSLPHGENGTPPAADQPRFPAVRAFEENRLNTILRIKDINSPPSGQLAFMPQRRQPGGG
TVNPLCVLDVTLPRLAPSMIQEQNENRLKDSVANFFNGIPKENGCGSIGHRYAKCRLIDS
IARSELDLKKVAENLGRDWLRVAPFLGLSVEDISSIREKGAGSDYIMALTCLTLWQERNG
PTATGTALAQALKSADQENVIRQSMQNISLVQHDPELSHALRSLETSDGAPATISAAVKE
DLIEESLTVRPTATAPVTVAMDDEIVEETISPTEISPQPHPQSESTTDAGTEENKATLEA
LIEQIEADDADYLAPLTDVSPTGAAIEEEELVPVIAHHGIELESAVPAFILEDLEREGTG
TTTSSPSHHIEPLDVDDIATAGDGIFSMTYNLNESRLKPVSMLEEQRLEKSAVSTSDVDI
MIALHAQNAASTQQQQQQEMEISDRNLAIFCPNQQRSSSTASMEKFIIPEAYNKQSASVP
LKSEDVEKSANSSIVDDEWIIHPVVQPLCGWNEATWGKPQSPRHSPKQQSSMLMEGKNND
VHDDSIIIPTSYPLCGWNEATWGKPQSPRHSPRQSVVTENFDNNDFIIKPVDCPMCGVNE
ATWGRPQSLRQSLSQNDALLIVSNAAERLREREKTGEEPKELHK
Download sequence
Identical sequences HmN_000348100.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]