SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HmN_000481000.1 from Hymenolepis microstoma

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HmN_000481000.1
Domain Number 1 Region: 44-105,136-311,340-385
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 3.6e-46
Family IF2B-like 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HmN_000481000.1
Sequence length 419
Sequence
MSSTDATIDSFSIGRKKKSGKYNCAIDIHINKCATVIDEPQNPTTVALNTLGYLKDVVLS
KKWENAAQLLALLKRTGKILLANSFENVPMHNTIQRIIKTVKDVIANIVPNSNASQKQHQ
LMVTVDEGEVDLSFITREELIDGVMEGFNDLDDDIKSQHGSITCSSLNFIHSDELILTVG
YSKLVLDFLKYAASKNRQFRVIVCEGFPDNGGHKMANELASDDISVILAPDSHVFALMAR
VNKVILSCYAVYPDGALKALTGSEATMLAAQRFSVPIYVCLPSILISPLNLQMLPGCSNA
LNVHAECYPGSLKDSSDFVDLSLNGLEPTYKMLPPSVSSKCNMGPPPQVHLPTWDYIKPG
LTTLFLTSDNGAAPSYLYALVRDLFSLPETNESLTWFEDYDTEESTPNHFTITAVEVNN
Download sequence
Identical sequences A0A068XST3
HmN_000481000.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]