SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HmN_000670200.1 from Hymenolepis microstoma

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HmN_000670200.1
Domain Number 1 Region: 332-531
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000239
Family Tropomyosin 0.007
Further Details:      
 
Domain Number 2 Region: 590-855
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000301
Family Tropomyosin 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HmN_000670200.1
Sequence length 1160
Sequence
MLQNGGFSDDCQSDQKIPESENPKINSRNRNMYQVEADLDENARQVRTFLLRAEEDKRRL
AQRIDQLITNERVLILELERLKRRGGGSTAGTTNNGRSSQKKATSNLEEHIAGLIQDRDY
WKGQVELLSQMLACPSIVGLRNAKPLITGSKIGSAPKLARSKSQRESRYKIKEDNKILPE
SRGEVRQTKCRLSTGAPPFTRSQSLPREHQSCEESLENQKLRLERDELRMMLNGFEKRIQ
EIQINVQTLTKERDDLNRLYADAKNEIHRLHHDLYDVQNASNRRAASQETHLQNDLDRAR
WEIEQLKAEKESLAAKYKKASEMESADKLRHSKQMDYMEKALSEATNERDEVIARIGQLK
RRLEELQTNQMQIEQRLNEKNEKLKKCVEESNNLRHELETRQRALEETETKLVAAQNRSI
ELEAVCQQTEASSEETGRRLLLEKDTNSRLQAELQDANLERNKMHQEIEELMRAKSQLQK
SNKYLEKKCMSTITERDEVNSNCNRLAADINSLQQKLKIAEMDIATWSNKFNLERSAKES
FADRCMLAEKRLEECEFRGQNLSNELREHQDARYQLERQVKTLAESAERLKASVERLAGE
NETLKTNIDLANKDKVKLEECIEDLTAANRQLIRDRDDCTHRYSLARERITELESDLRNM
EDEIKRQTGVANKERQSAVDFRKENDSIKQRCEELTTELAGMVNRNRSAEERFHQAEIRA
TQLERELRMEHDDYLQIRSRLEATEEQRDAGEANRKLMAQRISELESQVTAQLMEIKETR
STLEENTRMLSRKEEQLMTIQASEQSLRSELAAAQSSIRESRRVIDTGEQETLRIRDELA
STMRDIQRLTAELHNTEGDREALKARADGYLSELARQERLLDERARERDLLAEQARAATE
DAEVWRARWTDAETAAANARLQSDERSNEIARLRDTLEGKDRELMQYKSALSKAELQVQN
LGQQNTESGEAAGLARAEVEALSSEVSRLREVLGRAEAARGALELEAVHARVAAEEARAK
AAAAEADAAAAHESAAVERENARNANFLLQSVKEKERDVTAEVQERTNEVMALRERAILA
EERAEAQQREMARLYERLVESEKAASRISRSLSTERFERERERYPPEMRSVPGSYRASAY
SVSSGRYTTARLRSPHREKE
Download sequence
Identical sequences A0A068X229
HmN_000670200.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]