SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HmN_000855200.1 from Hymenolepis microstoma

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HmN_000855200.1
Domain Number 1 Region: 318-414
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000000244
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.014
Further Details:      
 
Domain Number 2 Region: 131-189
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000475
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.051
Further Details:      
 
Domain Number 3 Region: 47-89
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000288
Family HLH, helix-loop-helix DNA-binding domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HmN_000855200.1
Sequence length 860
Sequence
MVDDWVIKTMYATKRRRKNTKMVTNQLAEVGYKVENGSGNTKSNPSKRHRERLNAELEHL
ASLLPFEQSVIVKLDKLSILRLAVSYLRMKGYFQALSYDHPMLEQHRLVSHLYHCPLDIV
QMEGEASLQALNGFIFIVSCDGEVFSVCKTVEHYLGFHQSDILHQSVMELIHSEDRDEFH
RQLSWQAMLPPEHRNLTLQEVLSPAYSHLLQRCFTVRFRCLLDNTSGFITLEISGRLQFL
HGHARNFQLTSSPTRGGSGGDGNPRQGRQELTPEGHGLSASSLPANTIPPSSFGLFGVCS
PLGSLPSLDGSQRETSFKTKHKMDLTFTSMDSRARSMFGYNGKEDGRVKIYDLIHPEDLS
YVAQGHREVLKQASIGLLSHRWLSNTGSWIWLQSRLRIVYKDNKADHIIAIHRKLDDTEG
NELYYRRNSEYKLPFPLLEPETLMSEDDSNEVNGNDLSVREGSSIPEVKSFTEDSNDAQV
KVSPQIDSEKDGTSRKLWNSYESNSQESGSTSEVKPAGSKKFKGQLKNYLQTTRRRKTPF
RAPSSTPKSVTRSSASLYPSLEASSSSTSWYNYRSLFGRNFLSPTATKTDDYMQNYAMYG
YGGSSTRNPYSYQGWDFEKAKNEEDAYCGMQSGDHAQVNGFAYALPYSNNDYSSAYEAYS
AAVAAAAVVAAASGQSQCSEYSTPSTLHHHQDHESYDGAVRVIRSPLIYNTPIQDQQSYL
SHQQPTTGDNQLQGLPTFSGYLQHKEEEGIECSGSDLISKLALKTDPRMTQPAWFPHIGL
SNEKSQSLNQMAAYQQHPMLSGNTDTLVRSSSGYSHESVMDQTQCTNLIPWNNFENRTSC
VGDANLCETANYHVGFATTS
Download sequence
Identical sequences A0A068XGK9
HmN_000855200.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]