SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|376294874|ref|YP_005166104.1| from Desulfovibrio desulfuricans ND132

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|376294874|ref|YP_005166104.1|
Domain Number 1 Region: 15-169
Classification Level Classification E-value
Superfamily PUA domain-like 1.79e-33
Family ATP sulfurylase N-terminal domain 0.0000624
Further Details:      
 
Domain Number 2 Region: 387-558
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.45e-30
Family ATP sulfurylase C-terminal domain 0.0038
Further Details:      
 
Domain Number 3 Region: 170-382
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 1.24e-28
Family ATP sulfurylase catalytic domain 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|376294874|ref|YP_005166104.1|
Sequence length 563
Comment adenylylsulfate kinase [Desulfovibrio desulfuricans ND132]
Sequence
MQYTDSLPAHNAENLLVHFRRVELLKERATEFKSVNLNPRQLCDLEMLLNRAFYPLDGYL
GRKDYESVLESMRLSDGTLWPLPLCLGVSAEFAASLTPGESVAVRDAEGFMLAVLTVSEV
WKPDLAAEAAAIRGEGALPGPEDGCSCGLAEPWYIGGRVEGVSFPQRYDFTEIRLTPAEV
QRSFVQKGWRKVLAVQAGRPLHKADRAMLEEIARDQGASLLLSPLLKPSMYFSVSHFSLV
RSFQQFTETFPRSMAKLNLTPWFERHMGPRGALLRAIVNKNYGCTHMLVWDAAKAEPRQN
ALSEEYEAHIRWLMDHAADTGITPVAEHCMALDRASGQYVRSDTGGLCANDHDAVVDLLS
RGEPVPDWMSFPGVLKELSRTYKPRREQGFTLFFTGLSGAGKSTLAKVLFVKLLELNSRP
VSLLDGDIVRTNLSSELSFSKEHRNLNVTRIGFVASEIVKNGGVAICAPIAPYAESRRHA
RAAVEEYGGFIEIHVSTPLAVCEQRDRKGIYAKARAGIIKGLTGVDDPYIEPENPELRID
TSELTPNEAAHEVLLYLSEHKYL
Download sequence
Identical sequences F0JCX2
gi|376294874|ref|YP_005166104.1| WP_014320728.1.15463

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]