SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386345281|ref|YP_006041445.1| from Streptococcus thermophilus JIM 8232

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386345281|ref|YP_006041445.1|
Domain Number 1 Region: 429-449,487-736
Classification Level Classification E-value
Superfamily HAD-like 6.31e-60
Family Meta-cation ATPase, catalytic domain P 0.00032
Further Details:      
 
Domain Number 2 Region: 234-330
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 1.27e-28
Family Calcium ATPase, transduction domain A 0.0039
Further Details:      
 
Domain Number 3 Region: 2-73
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 1.96e-22
Family HMA, heavy metal-associated domain 0.00089
Further Details:      
 
Domain Number 4 Region: 189-234,331-424
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.0000000000248
Family Calcium ATPase, transmembrane domain M 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|386345281|ref|YP_006041445.1|
Sequence length 743
Comment cation transporting ATPase, copper transport [Streptococcus thermophilus JIM 8232]
Sequence
MSKETFVVNGMTCASCVANVENAVNNLDGVDKAVVNLTTEKMSVDYSGNKVSPEAIEKAV
ADAGYEAQVYNPDTAKSQEEREEDKIHKVRERLIWSSVFTIPLFYLAMGPMVGLPVPNFL
SPHHAALTYALVLLILTVPVMWLGRSFYSNGFRTLAKGHPNMDALVALATSAAFLYSLFG
TYHISLGHVHHAHQLYYESVAVILTLITLGKYFETLSKGRTSDAIKKLMHLSAKEATVLR
DGKEVKLPVDKVVLGDHIVVKPGEKIAVDGQVISGSSAIDESMLTGESLPIEKSVGKPVF
AGSINGQGSLIYEAEKIGKDTLLSQIIKLVEDAQQTKAPIAKIADQVSAVFVPVVMAIAF
VSGLFWYFIMGQTFTFAMTVAVSVLVIACPCALGLATPTAIMVGTGLGAEHGILYKRGDV
LELAHKADVLVFDKTGTITQGKPQLVSSYTYGNSGVAALQLLASLEAKSEHPLSQAILVA
AENANLDVLEMDNFSSLTGRGLTASYAGKTYLAGNQTLMAEEKVDLTSAQADFQNLTDDG
ETPIFLAEDGKLIGLFGVSDQVKADSADMVAALHQMGKEVIMLTGDNDQTAQAIAQKVGI
KRVISQVLPQEKSRVISDLQVEGKSVIMVGDGINDAPALATADIGIAMGSGTDIAMESAD
MVLMKPNLMDVVKALKISQATITTIKENLFWAFIYNILSIPAAMGVLHLFGGPLLDPMIA
GFAMSFSSVSVVLNSLRLKRCKI
Download sequence
Identical sequences F8LZ03
WP_014621884.1.96332 gi|386345281|ref|YP_006041445.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]