SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|390937831|ref|YP_006401569.1| from Desulfurococcus fermentans DSM 16532

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390937831|ref|YP_006401569.1|
Domain Number 1 Region: 250-603
Classification Level Classification E-value
Superfamily SIS domain 8.35e-77
Family double-SIS domain 0.000011
Further Details:      
 
Domain Number 2 Region: 3-226
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 9.44e-45
Family Class II glutamine amidotransferases 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|390937831|ref|YP_006401569.1|
Sequence length 604
Comment sugar isomerase (SIS) [Desulfurococcus fermentans DSM 16532]
Sequence
MGGIFGVICSTTIPRGLIVTGLRRLLYRGYDGAGVVFPVDKGLEIRKAPGHLDNVVKQVD
LENIPSRIALAHTRYASRGWPVYENTHPLTDCNGEIAVVGDGIIDNYEAYRTGLEKEGHI
LRSRTDTEIAAHLLEKYYTMEKDLLRALLRVGSELKGLYSLAFLVSGVDGILFIQNGQPL
VIGIGSQCVYLSSDLTSLHGLADTAYIIEDRMAGLISLEKQVLYRISTGEHVDLASLQSK
RVKYGIEYVEKAGFPHYMLKEIYETPDAIYRTTIAIMDKYLRLASMIIHGARDVYIVANG
SSLHAGLVASYYFAELAGLSITPVSAAEFPYSILESITTGSVLVAVSQSGETSDVINSVK
LAKQRGAVIVGVTNNVGSRLALESNVYLPIGAGPEIAVPATKSFSATIAALLLLASYTGI
FNGKQSFNDYNTIINEIRNTSKELKELITRFDSRITSIVNSLPLFYNVYVAGSGITYPIA
LEGALKLKEAALIHAEGVQLGELRHGPLTLVSHEFPVILIEPFEEPAKQLYLKVVKEVLN
REAMLFSININNASCKNICVEVPGKKYLYPVIATIPLQLFSYRIGVKLGRPIDHPPGLAK
AITT
Download sequence
Identical sequences I3XPX0
WP_014766899.1.2099 gi|390937831|ref|YP_006401569.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]