SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|390938283|ref|YP_006402021.1| from Desulfurococcus fermentans DSM 16532

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390938283|ref|YP_006402021.1|
Domain Number 1 Region: 6-188
Classification Level Classification E-value
Superfamily LigT-like 1.06e-39
Family 2'-5' RNA ligase LigT 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|390938283|ref|YP_006402021.1|
Sequence length 189
Comment 2'-5' RNA ligase [Desulfurococcus fermentans DSM 16532]
Sequence
MSGEIIRCFIAIELKNQEVLRRLIEVRDKITATGVDLKPVEDENIHLTLRFIGEVPRSVV
DEVCGFINTISYKGFQIHVKNIGGFPSLEKPRVIWAGVEEGSDELLELYRIVEAGLRRIG
IKPEREEFTPHITLARVKGYRGIEKLVKTLMELRETDFGYSPVEEVIVKKSVLTPRGPIY
SNICVKKLA
Download sequence
Identical sequences I3XR72
WP_014767347.1.2099 gi|390938283|ref|YP_006402021.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]