SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|390938440|ref|YP_006402178.1| from Desulfurococcus fermentans DSM 16532

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390938440|ref|YP_006402178.1|
Domain Number 1 Region: 30-279
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 1.54e-38
Family ROO N-terminal domain-like 0.0000485
Further Details:      
 
Domain Number 2 Region: 258-384
Classification Level Classification E-value
Superfamily Flavoproteins 2.7e-23
Family Flavodoxin-related 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|390938440|ref|YP_006402178.1|
Sequence length 400
Comment beta-lactamase [Desulfurococcus fermentans DSM 16532]
Sequence
MEYNVSKLTSNLYLLRFKDTRTKYFEGLWEIPEGIMYNSYVYTGNEGAIIFDTWKIGLGN
EFLEALRNIVDLGDVRYVVVHHMEPDHSGILKTLVEKADPIVLGHPLVKNMAESFYSVSM
KFRPVKDGEEIVFDDEKIIFHHTPWLHWPETIMSYITSGKILLTCDAFGSYGVFKEVWAD
ELSGEDYERYLWYAKKYFANVIGIHYEWVVKNLEKLVSRGVTPNLVLPSHGLLLRGDPLD
YMYKKYMSWGHGEPERGKTLLIYTSMYGFVERTVKIIREYFSGLNQDIDIIGFTDSNRPN
ISDVIGEAFDAENIILASATYDADLYPLMKHIASLITRKTPREKKVAIIAQYGWGGKAGK
ILEEIMNTQGFKVVGVVEFKAGEEEKYRDKIIGLIESLKK
Download sequence
Identical sequences I3XRM9
gi|390938440|ref|YP_006402178.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]