SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|390938471|ref|YP_006402209.1| from Desulfurococcus fermentans DSM 16532

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390938471|ref|YP_006402209.1|
Domain Number 1 Region: 141-361
Classification Level Classification E-value
Superfamily Creatinase/aminopeptidase 3.4e-69
Family Creatinase/aminopeptidase 0.00000929
Further Details:      
 
Domain Number 2 Region: 5-140
Classification Level Classification E-value
Superfamily Creatinase/prolidase N-terminal domain 0.00000000082
Family Creatinase/prolidase N-terminal domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|390938471|ref|YP_006402209.1|
Sequence length 368
Comment peptidase M24 [Desulfurococcus fermentans DSM 16532]
Sequence
MSRELRIGKLISLMESHGLQDIVLVSPENIEYYTGVETVADATLLLHATRGGGVSIYVPL
LEYYRYRDSLPGEVEVYAYSKTLKPSDARIVEKDYREILKEIIDKSSKIGIDKPLQDTPI
QQETHSDRVVDISGDVWKHRMIKDEEEIEAIREAVDITIKGIKTIQDNISEGVTEAELAG
FFEERVRREGVKKYAFDPIIAFKPGNSYPHILPGSKKLGRRDLVLIDVGVKYRGRCSDLT
RMVTWGRPTPDERRSLEAVEEALWESIDSIYPGIKAGDVAEKAVKKLEKYGLHERFIHGL
GHGIGIAVHEPPYLRLGSSTLLEPGMVFTIEPGVYFNGRYGVRMEEDVLVTRKGVRVLSR
RLKPLLTL
Download sequence
Identical sequences I3XRR0
gi|390938471|ref|YP_006402209.1| WP_014767534.1.2099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]