SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|390938492|ref|YP_006402230.1| from Desulfurococcus fermentans DSM 16532

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390938492|ref|YP_006402230.1|
Domain Number 1 Region: 92-224
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 4.5e-20
Family Cytidylyltransferase 0.0072
Further Details:      
 
Domain Number 2 Region: 5-80
Classification Level Classification E-value
Superfamily AF1782-like 3.79e-19
Family AF1782-like 0.00083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|390938492|ref|YP_006402230.1|
Sequence length 229
Comment cytidyltransferase [Desulfurococcus fermentans DSM 16532]
Sequence
MTAQCDRVKAYIDNVEQVLQQATAIRELDPRHRYIIELARSYASDAKYYLEKNDCFTSLA
CIAYAEGLLDSLRYQNIISFNWKPLSELLKRPRVLVAGSFEFLHPGHIYLLKRAWELGEV
YVVVSRNRNFTRFKGREPIMDEKERLLIVENVKYVSKAVMGDEEDFLKPIVELKPDIVLL
GPDQWIQPDELKSLLEKKGLSNVRVEKLESRIGEWSSSRIIERIKNKYC
Download sequence
Identical sequences I3XRT1
WP_014767555.1.2099 gi|390938492|ref|YP_006402230.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]