SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|390938518|ref|YP_006402256.1| from Desulfurococcus fermentans DSM 16532

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390938518|ref|YP_006402256.1|
Domain Number 1 Region: 6-119,224-419
Classification Level Classification E-value
Superfamily Substrate-binding domain of HMG-CoA reductase 3.14e-99
Family Substrate-binding domain of HMG-CoA reductase 0.000000311
Further Details:      
 
Domain Number 2 Region: 112-218
Classification Level Classification E-value
Superfamily NAD-binding domain of HMG-CoA reductase 7.85e-30
Family NAD-binding domain of HMG-CoA reductase 0.000063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|390938518|ref|YP_006402256.1|
Sequence length 427
Comment 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Desulfurococcus fermentans DSM 16532]
Sequence
MEKTSRIQGFYKLSLEERRRIVCEWAGLTEEECRTLSEFGNLPVKIGDSMIENVIGAMSY
PLAVATNFLINGRDYLVPMVIEETSVVAAASNAARMLRHGKGILANAERQEMISQIHLVK
VNSPRFKAMKIIEAKKELLDYAAQQDPTLLKYGGGPRDLEVRVMEHPALGGIIIVHLVVD
VRDAMGANTVNTMAEAIAPLLEKITGGEARLRIVSNHAVYRVARAWAVTPVEEVGGLEVA
RKIMEASILAEIDPYRAVTHNKGIMNGVIAVALATGQDHRAIEAGAHAYASRTGVYKPLS
YWEVTSDNYLAGSLEIPLQIGVVGGAVKVHPVAKIALKILGVNTARELAEVMAAVGLAQN
LAALRALVTEGIQKGHMRLHARNLAIMAGASGDLIDRVAEKMIRDGRIRYDYAKQLVEKA
LQGEPLD
Download sequence
Identical sequences I3XRV7
WP_014767581.1.2099 gi|390938518|ref|YP_006402256.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]