SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|390938574|ref|YP_006402312.1| from Desulfurococcus fermentans DSM 16532

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390938574|ref|YP_006402312.1|
Domain Number 1 Region: 8-115
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 9e-30
Family Single strand DNA-binding domain, SSB 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|390938574|ref|YP_006402312.1|
Sequence length 152
Comment OB-fold tRNA/helicase-type nucleic acid binding-protein [Desulfurococcus fermentans DSM 16532]
Sequence
MSSNPNKEETPPTNIIDLKPGMEKVTVKARVIKIEAPRVIRTKKGPRTISNAILGDETGR
VETTLWGEKAGTLQEGDAVEVHGAWTTEFKGKVQLNIGKSSEIVKIDDSSVPHSGEIPED
SPTAPPGSGGISRPPRRQFGGRRGPRRSDVDE
Download sequence
Identical sequences I3XS13
WP_014767637.1.2099 gi|390938574|ref|YP_006402312.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]