SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|390938585|ref|YP_006402323.1| from Desulfurococcus fermentans DSM 16532

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390938585|ref|YP_006402323.1|
Domain Number 1 Region: 70-329
Classification Level Classification E-value
Superfamily PLP-binding barrel 3.27e-39
Family Alanine racemase-like, N-terminal domain 0.0053
Further Details:      
 
Weak hits

Sequence:  gi|390938585|ref|YP_006402323.1|
Domain Number - Region: 533-572
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 0.00785
Family Eukaryotic ODC-like 0.011
Further Details:      
 
Domain Number - Region: 358-401
Classification Level Classification E-value
Superfamily ATP synthase D chain-like 0.0432
Family ATP synthase D chain-like 0.01
Further Details:      
 
Domain Number - Region: 435-508
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 0.0513
Family Eukaryotic ODC-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|390938585|ref|YP_006402323.1|
Sequence length 587
Comment arginine decarboxylase [Desulfurococcus fermentans DSM 16532]
Sequence
MNREEWDINVAKELWGLNHSIRGSIIAVDEEGYLVISLGEQKIRVKNLLEKHGFDVAYIR
VLPLIERTMRTVYETFTELAKVHDFKGGLQPVFPMKVNPIEVVIDAIWRYGEKYRWGFNT
GSLGELELLSKYLEKGGRILIYDGVVSDSVMKILVRFKGNGWRVIIDVESEHDLDILSKY
PEFEIGLRIKPLFRPGGKWAHSAGLEGKFGLTVNTLVKLREEYKWIEERSRLLHIHPGSQ
IYKWSDIEAFINEAYNIFTQLQSHGFTSIEIVDLGGGLAYPYLDTRNGTIESPDYGLIEY
FNHILKVFSRLEKHPTLVYEGGRYIVSAHRILVAKVVDIRPYSTEQAQSLRSVRVEDFLS
NVRSIDDLKKLVNEYKKYIHKSKQVHQYTLEERELAEDVISKVRDELLAKIYELVRNKPS
QIESVINDPLLYKLVTSPSKRYILNFSIFADIPDSVLVNQYFQVVPAQRLNEKPDVLAVL
GDLTCDSMGEINEYISHVKTPLEASDWFTKMDLRLMLIPGRRLKLGGVPLHLPIKGENYY
IAILDTGAYQDPLAMKHNLIYGAPEIILDEKNGEVEVKIIEKNGKYL
Download sequence
Identical sequences I3XS24
gi|390938585|ref|YP_006402323.1| WP_014767648.1.2099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]