SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|390938784|ref|YP_006402522.1| from Desulfurococcus fermentans DSM 16532

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390938784|ref|YP_006402522.1|
Domain Number 1 Region: 2-138
Classification Level Classification E-value
Superfamily HydA/Nqo6-like 9.81e-36
Family Nq06-like 0.00043
Further Details:      
 
Domain Number 2 Region: 202-327
Classification Level Classification E-value
Superfamily Nqo5-like 5.49e-33
Family Nqo5-like 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|390938784|ref|YP_006402522.1|
Sequence length 337
Comment NADH ubiquinone oxidoreductase 20 kDa subunit [Desulfurococcus fermentans DSM 16532]
Sequence
MLERIARWAYARSLWMIHYCSACGAVEFPPLVMAPLDWERYGYMPTPSPRQSDLYIGMGY
LTKKTVKLVLNMYRQMPEPKLVLAGCNCTSTGGLYWDSYATYKRLDDFIEVEGWVPGCMP
MPDDYLSMIEHVRKDLGKRPLNAYVSKIKPDAFKKISEWEELEKQWRREYEEKIKEDSSK
PVSYEFKETYPSCYEKDEKSKICRTSVNPEKIRDALVDLKNKGNVLFVNINTVDYPDKGV
IEVYYVLENPSDGSQVWVKTYVKRASPEIDSVHDIFPVAKYIEREVYEFMGVVFRNNPEL
KKWILDGNWEGPPPLRKDVDTAGFVVKTMYGGYKYGR
Download sequence
Identical sequences I3XSM3
gi|390938784|ref|YP_006402522.1| WP_014767843.1.2099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]