SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|390938805|ref|YP_006402543.1| from Desulfurococcus fermentans DSM 16532

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390938805|ref|YP_006402543.1|
Domain Number 1 Region: 4-161
Classification Level Classification E-value
Superfamily Bacterial fluorinating enzyme, N-terminal domain 3.79e-62
Family Bacterial fluorinating enzyme, N-terminal domain 0.00032
Further Details:      
 
Domain Number 2 Region: 167-262
Classification Level Classification E-value
Superfamily Bacterial fluorinating enzyme, C-terminal domain 7.85e-21
Family Bacterial fluorinating enzyme, C-terminal domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|390938805|ref|YP_006402543.1|
Sequence length 268
Comment hypothetical protein Desfe_1096 [Desulfurococcus fermentans DSM 16532]
Sequence
MSNRIIALITDFGYRDPYVGVMKGVIKSINPGAEIVDLTHGINRHNIIEAAVVLMVSARY
FPPSTIFVVVVDPGVGSNRRAIVVETSNYILVGPDNGCLSLLALKDGVKRVVDISNSRYR
LGNVSHTFHGRDIFAPVAAWISRGIPLEAIGTEIPVDSLKTIRIEPPRISDDLIEGHALY
IDIYGNVMTNISEDEAYSILRLGDKIEIIHQGGKSQCMFTTSFSIVNPGEVACYINSWGY
LEIAVNNGSVADAFGIIQGSRLLFKKLP
Download sequence
Identical sequences I3XSP4
WP_014767864.1.2099 gi|390938805|ref|YP_006402543.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]