SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|390938821|ref|YP_006402559.1| from Desulfurococcus fermentans DSM 16532

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390938821|ref|YP_006402559.1|
Domain Number 1 Region: 82-192
Classification Level Classification E-value
Superfamily V-type ATPase subunit E-like 0.000000000000034
Family V-type ATPase subunit E 0.0016
Further Details:      
 
Weak hits

Sequence:  gi|390938821|ref|YP_006402559.1|
Domain Number - Region: 13-73
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit B, membrane domain 0.00425
Family F1F0 ATP synthase subunit B, membrane domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|390938821|ref|YP_006402559.1|
Sequence length 192
Comment H+transporting two-sector ATPase E subunit [Desulfurococcus fermentans DSM 16532]
Sequence
MVALESEAIKARLLEEARTRAEEIVKEAEKEAERKIREAEALWREKAEKERMRIISEAEK
EANNIVSDAVREARFIISMEVDNIISDILNQAYSVIRSRGFDVKASLKNLITESMKVIDS
PRRLIVSRRDLETAREVVTELGLTGVSIEVGDIEGGIIVESASGIIVDNTYESRFKEFQN
KYLNEVRRILWG
Download sequence
Identical sequences I3XSR0
WP_014767880.1.2099 gi|390938821|ref|YP_006402559.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]