SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|390938988|ref|YP_006402726.1| from Desulfurococcus fermentans DSM 16532

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390938988|ref|YP_006402726.1|
Domain Number 1 Region: 468-593
Classification Level Classification E-value
Superfamily vWA-like 0.000000000000131
Family RoRNP C-terminal domain-like 0.013
Further Details:      
 
Weak hits

Sequence:  gi|390938988|ref|YP_006402726.1|
Domain Number - Region: 585-628
Classification Level Classification E-value
Superfamily Tryptophan synthase beta subunit-like PLP-dependent enzymes 0.0115
Family Tryptophan synthase beta subunit-like PLP-dependent enzymes 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|390938988|ref|YP_006402726.1|
Sequence length 636
Comment VWA containing CoxE family protein [Desulfurococcus fermentans DSM 16532]
Sequence
MRYSDNVEELRRLIDERIRVELDELKETLGEFKKAPIDKVVLYIGMKLALSMITSNSVLL
AELRGKLIESLGLTDRTQVEPSGTVELFTLDEKLYRRLGRTRFLTISGMLGEESSRREIL
TYIWMRKAGILKKRSNGSLVVDRDELSRYRAGSTYRLELNDIKRFLGEIPSRLWGKVLTE
DLLNSVKTGDLVSLAEKFYGFNHSVDSRIIGELRRRIVEGWMPSFNDARRLEKVLGRVLK
GVKADIPPHLLQYMDNAAEYVKGKERVLVERIEELPLKERWGVLRGLRQRVRDADFYRHL
NPLSLMELKSLGSLDKALASKIMLGEVIGSYVEYMLTRDTSFKAYALYIAERIDPSMLEP
MYRPVLESIIVGDEKKLLFHLGREIGFDLIELISIKLTEEYSRSGAIDQALVKRAIAIGM
RLLNYMKGREGLARRIEKTGLRGRLDTRGTVYKRIRLSNEIVYRRHRRRQRMIGIVDVSG
SMARFALWSILSLAVLFPSVSYIVLFSERSNVYRSPVKKTARMLAGFLEKLYTEGFKGYT
NISDALRRAGELALRSNSKTMVLFSDLKQTIPDVDPWIVAGELVKKGLKVIIVVPRSIEE
ETIEKYRKEGCDVVVVENPENIANILKRRINLKNRV
Download sequence
Identical sequences I3XT77
WP_014768043.1.2099 gi|390938988|ref|YP_006402726.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]