SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|390939084|ref|YP_006402822.1| from Desulfurococcus fermentans DSM 16532

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390939084|ref|YP_006402822.1|
Domain Number 1 Region: 198-280
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.0000000000000157
Family Multidrug resistance efflux transporter EmrE 0.011
Further Details:      
 
Domain Number 2 Region: 46-137
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.00000000144
Family Multidrug resistance efflux transporter EmrE 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|390939084|ref|YP_006402822.1|
Sequence length 291
Comment putative permease, DMT superfamily [Desulfurococcus fermentans DSM 16532]
Sequence
MLSIGVNYLSILLIVIATIIWGTTGVVAKYCFNMGVSPEELLVLRLGLTVPFYLYYALRR
GVAARTLLLGLLLLGPYHIVYFNAINMIGVSTTVLLFYTYPVIVAVASMITLNEEMGAGT
VVALILSITGSSLTSLDELSLNPMGVALALLSSLLYAAYIVYSKKILVEGEDPLGVALGS
STGALVPVLLAYISRGVHVEGFLRPSVILSSLYLSLVVTILGYLLYMKGLRSTNASIASM
LSSMEPLTATILSTLIFHEPLTLAKITGGALIILAIILISHIHTGSQKSST
Download sequence
Identical sequences I3XTH3
gi|390939084|ref|YP_006402822.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]