SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|387866276|ref|YP_005697745.1| from Edwardsiella tarda FL6-60

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|387866276|ref|YP_005697745.1|
Domain Number 1 Region: 19-338
Classification Level Classification E-value
Superfamily FMN-binding split barrel 1.84e-124
Family UbiD middle domain-like 0.0000000000574
Further Details:      
 
Domain Number 2 Region: 339-501
Classification Level Classification E-value
Superfamily UbiD C-terminal domain-like 9.68e-67
Family UbiD C-terminal domain-like 0.0000000443
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|387866276|ref|YP_005697745.1|
Sequence length 511
Comment 3-polyprenyl-4-hydroxybenzoate carboxy-lyase [Edwardsiella tarda FL6-60]
Sequence
MKNAYNGLFTRIDKNAMKYRDLREFIALLEQRGELKRIQQSIDPYLEMTEIADRTLRAGG
PALLFENPKGYDIPVLCNLFGTPQRVALGMGQEEVGALRDVGKLLAFLKEPDPPKGFRDL
VEKLPQFKQILNMPTKRLSKAPCQARVFQGDDVDLATLPVMHCWPQDVAPLVSWGLTVTR
GPCKSRQNLGIYRQQVLGKNKLIMRWLSHRGGALDFQEWCQAHPGERFPVAVALGADPAT
LLAAVTPVPDSLSEYAFAGLLRGHKSEVVKCLSCDLEVPASAEIVLEGYIEPGETAPEGP
YGDHTGYYNEVERFPVFTVTHLTQRDRPIYHSTYTGRPPDEPAVLGLALNEVFVPLLQKQ
FPEIVDFYLPPEGCSYRMAVVTMKKQYPGHAKRVMMGVWSFLRQFMYTKFVIVCDDDINA
RDWQDVIWALTTRMDPARDTLLIENTPIDYLDFASPVSGLGSKMGLDATNKWPGETQREW
GHPIVMDEAVRVRVDTLWNELDIFANDKDAQ
Download sequence
Identical sequences A0A0H3DM60
gi|387866276|ref|YP_005697745.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]