SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|387866860|ref|YP_005698329.1| from Edwardsiella tarda FL6-60

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|387866860|ref|YP_005698329.1|
Domain Number 1 Region: 3-153
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 7.36e-56
Family Deoxycytidylate deaminase-like 0.000000999
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|387866860|ref|YP_005698329.1|
Sequence length 170
Comment tRNA-specific adenosine-34 deaminase [Edwardsiella tarda FL6-60]
Sequence
MTQRDDSDWMRHALQLAEKARAQGEVPVGAVLVLNDRVIGEGWNRPITRHDPTAHAEIMA
LQQGGAIMQNYRLLEATLYVTLEPCVMCAGAMVHSRIRRLVYGAPDLKTGAAGSLLDVLG
HPGMNHRIEVCGGVLADACAAQLSDFFRQRRAQKRAERDARRRAERDDAE
Download sequence
Identical sequences A0A0H3DS36
gi|387866860|ref|YP_005698329.1| WP_015683243.1.32191 WP_015683243.1.39507 WP_015683243.1.83294 WP_015683243.1.91532 WP_015683243.1.93598

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]