SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|387869149|ref|YP_005700618.1| from Edwardsiella tarda FL6-60

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|387869149|ref|YP_005700618.1|
Domain Number 1 Region: 21-271
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 1.35e-78
Family FdhD/NarQ 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|387869149|ref|YP_005700618.1|
Sequence length 274
Comment Formate dehydrogenase chain D [Edwardsiella tarda FL6-60]
Sequence
MNKRASLLPQRVCGATTVPVWPRTEPSEPRPDWVANEVPVALVYNGISHVVMMASPKELE
AFALGFSLSEGIIRSPQDIYGMEVQTACHGLEVQIELSSRCFMALKARRRSLAGRTGCGV
CGVEQIGDALRPLAPLPFSQRFDLATLDGALARLREVQTIGNLTGCTHAAAWLDGEGVLQ
GGCEDVGRHVALDKLLGLRARQPGWQAGAALVSSRASYEMVQKAAMCGVEILFAVSAATT
LAIEVAERCNLTLVGFCRPGKGTIFTHPQRLLAV
Download sequence
Identical sequences A0A0H3DYS3 A0A1D7VCN9 D0ZGJ6
gi|269140677|ref|YP_003297378.1| 498217.ETAE_3336 gi|387869149|ref|YP_005700618.1| WP_012850133.1.32191 WP_012850133.1.39507 WP_012850133.1.79796 WP_012850133.1.82304 WP_012850133.1.83294 WP_012850133.1.91532 WP_012850133.1.93403 WP_012850133.1.93598

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]