SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|407461072|ref|YP_006738847.1| from Chlamydia psittaci WC

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|407461072|ref|YP_006738847.1|
Domain Number 1 Region: 112-186,216-288
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 6.22e-31
Family Ferredoxin reductase FAD-binding domain-like 0.018
Further Details:      
 
Domain Number 2 Region: 272-426
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 9.17e-24
Family Reductases 0.04
Further Details:      
 
Domain Number 3 Region: 45-129
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 1.05e-19
Family 2Fe-2S ferredoxin-related 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|407461072|ref|YP_006738847.1|
Sequence length 431
Comment ubiquinone oxidoreductase, Na(+)-translocating, F subunit [Chlamydia psittaci WC]
Sequence
MTWLSGLYFISIASVVFCVIGLILSGIILIARKFLVKIHPCKLKINDDDSLTKTVDSGRT
LLSSLLDSGIPIPSPCGGKATCKQCKVKIVKNADQPLETDRATFSKQQLEQGWRLSCQTK
VQHDMCLEIEERYLHASSWEGTVVSNDNVATFIKELVVSIDPAHPIPFKPGGYLQIRVPA
YKTNTSDWKQTMAPEYHSDWERFNLFGRIIDNSLLEPDSANKAYSLASYPAELPIIKFNV
RIATPPFINNAPNPSIPWGVCSSYIFSLQPGDKITVSGPYGESFMKENNRPLIFLIGGAG
SSFGRSHILDLLLDKHSTREITLWYGARSLKENIYQEEYEKLDKDFPNFHYHLVLSEPLP
EDIAAGWDKDDPEKTNFLFQAFELGQLSKLSNPEDYLYYVCGPPLHNSSILKLLENYGVE
RSSIILDDFGS
Download sequence
Identical sequences WP_014945649.1.21855 WP_014945649.1.33221 gi|407461072|ref|YP_006738847.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]