SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CBQ73054 from Sporisorium reilianum 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBQ73054
Domain Number 1 Region: 48-501
Classification Level Classification E-value
Superfamily DmpA/ArgJ-like 4.05e-110
Family ArgJ-like 0.00000459
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CBQ73054
Sequence length 504
Comment pep:novel chromosome:GCA_000230245.1:6:545585:547099:-1 gene:sr13718 transcript:CBQ73054 description:"related to ECM40-acetylornithine acetyltransferase"
Sequence
MISSLLSRSSLGRGAARSLSTSAVHLDASAKLNKPARFATPISASDIPKGFVVSSTYAGI
KAAISPKPASSSGGASNPNPKPDLALIVSTVPAAAAGTFTRNVFKAAPVVVSNRVLLDGA
EREAGARVQSVLVNSGCANAVTGTQGMQDAEACVELVKKHLAPHPGLAQSSEGRETLLLS
TGVIGVPLPMPAIKRCIPHLSNGMILRSDPESWRETARAFMTTDTFPKLRAKTFQLGGRD
VRMIGIDKGAGMIHPAMTSPTLPPSFGAASGQLHATMLGLIATDAAVQPAALQTALNRAV
SRSFNCISVDGDMSTNDTILLLANGQSSSTGAVAEIDETSADFEPFVAELTHFCQELSQL
IVRDGEGAEKFVEITCTHAPSYAVAHGLLSRLVTSMLFKCAIHGEDANWGRILASVGGAD
PALTADIDPARVSVSFVDPQGVLEPITVLRDGDPVKVDEALIGKLLTKEDVKIVIDLQNG
SEDCTYWTCDLSREYIAINADYRS
Download sequence
Identical sequences E7A0P7
CBQ73054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]