SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CBQ69625 from Sporisorium reilianum 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBQ69625
Domain Number 1 Region: 3-117
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.42e-37
Family Calponin-homology domain, CH-domain 0.0000271
Further Details:      
 
Domain Number 2 Region: 198-281
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 0.00000000000000111
Family EB1 dimerisation domain-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CBQ69625
Sequence length 296
Comment pep:novel chromosome:GCA_000230245.1:16:394064:395026:1 gene:sr16094 transcript:CBQ69625 description:"EB1-like protein"
Sequence
MGESRTELIHWINELLGFSYTKVEQCGSGAAYAQIIDSIYYNVPLVKIKFDAKHDYEYIN
NFKVLQEAFKRNRIDKPIPVDRLIRCKMQDNLEFLQWLKRYWDQNFAGEVYDAEARRGGV
GAAPPPLVGAVSVGAARTAASTRPAASTRPAAGAAPTTRPSARAAPPASAAARRPLAAAG
ARAGPSASAAAAVPNETIQALTAQMDEMKVSVDSLEKERDFYFAKLRDIEILVQERLSIL
AEQFPAPSEEEDPEGLHVGTEEQESLKQIQAILYSTEEGFEVPEGNEVAQDEEEMF
Download sequence
Identical sequences E6ZQW8
CBQ69625

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]