SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CBQ72948 from Sporisorium reilianum 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBQ72948
Domain Number 1 Region: 26-154,465-581
Classification Level Classification E-value
Superfamily GroEL equatorial domain-like 8.37e-85
Family Group II chaperonin (CCT, TRIC), ATPase domain 0.00036
Further Details:      
 
Domain Number 2 Region: 265-438
Classification Level Classification E-value
Superfamily GroEL apical domain-like 9e-44
Family Group II chaperonin (CCT, TRIC), apical domain 0.00047
Further Details:      
 
Domain Number 3 Region: 243-271,431-464
Classification Level Classification E-value
Superfamily GroEL-intermediate domain like 0.00000000000000217
Family Group II chaperonin (CCT, TRIC), intermediate domain 0.014
Further Details:      
 
Domain Number 4 Region: 154-197
Classification Level Classification E-value
Superfamily GroEL-intermediate domain like 0.000000128
Family Group II chaperonin (CCT, TRIC), intermediate domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) CBQ72948
Sequence length 585
Comment pep:novel chromosome:GCA_000230245.1:6:212094:213851:-1 gene:sr17132 transcript:CBQ72948 description:"probable CCT4-component of chaperonin-containing T-complex"
Sequence
MSAAAASIGAAPAARGGPSQNAFKNADKPDEVRRSNLSAAKAVSDAVRTSLGPKGMDKMI
QTANGEVVITNDGATILKHMAVMHPAARMLVELSQAQDVEAGDGTTSVVVVAGSLLGAAE
KMLNKGIHPTIIAESFQKAAAKAVEFLTDISTPVELNDRESLLRAASTSLNSKIVSQYSS
VLAPIAVDAVTRLVTPAASSGAAAAATSSTAAATTPAAAAAATSAAPGATSTTTSSRASR
SADSQDNVDLRDIRIVKKVGGTIDDTELVEGLVLAQNVISGSGGPARMEKAKIAVCQFQL
SSPKPDMDNQIVVNDYRQMDKILKEERQYLLNMCKKIKKTGCNVLLIQKSILRDAVNELA
LHFLAKLKILVVKDVERDEIEFVSKTLGAKPVADIEAFTEDKLGSAELVDEVQQNGARVV
KITGIKNMGRTVSILCTGANSLVLEESERSLHDALCVVRCLVKKKALIAGGGAPEVHVSR
LLSQYSQTLKGMEAYCFQAYAEALEVIPTTLAENAGLNPISIVTELRNRHALGERTAGIN
VRKGQITNILEENVLQPLLVNTSAIELATETVSLLLRIDDYHLSR
Download sequence
Identical sequences E7A0E1
CBQ72948

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]